KEGG   Actinobacillus suis: ASU2_05965Help
Entry
ASU2_05965        CDS       T02262                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asi  Actinobacillus suis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASU2_05965
   01230 Biosynthesis of amino acids
    ASU2_05965
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_05965
   00030 Pentose phosphate pathway
    ASU2_05965
   00051 Fructose and mannose metabolism
    ASU2_05965
   00052 Galactose metabolism
    ASU2_05965
  Energy metabolism
   00680 Methane metabolism
    ASU2_05965
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ASU2_05965
Protein phosphatases and associated proteins [BR:asi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ASU2_05965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1320666..1321640)
Genome map
AA seq 324 aa AA seqDB search
MTKQIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGIQDGYYGLYNDKVIQLDRRS
VSETINRGGTFLGSARFPQFKDPEVRKQAVETLKKYEIDALVVIGGDGSYMGAKLLTEEF
GYPCIGLPGTIDNDIVGTDYTIGYQTALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALASGCEYIIVPEKGLDKESLMRNIDEGFKKGKRHAIIAITELMTDVHQLAKEIE
ERFGHETRATVLGHIQRGGAPCPFDRILASRMGVYAVDLLLQGYGGRCVGIQNEKLVHHD
IIDAINNMRRPFKDELFDAARKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaatcaaaaaaattgctgtgttaacgagtggtggtgatgcgcctggcatg
aatgctgcgattcgtggtgtcgttcgtgcagcactcaatgaaggtttagaggtatatggt
atccaagacggttattatggtttatataatgacaaagtcatccaattagatcgtcgttct
gtatcagagacaatcaaccgtggcggtacattcttaggttctgcgcgcttcccgcaattt
aaggatccggaagtgcgtaagcaagcagtggaaacactgaaaaaatatgaaattgatgca
ttggtggttatcggcggtgacggctcttacatgggcgcgaaactattaaccgaagagttt
ggttacccttgcatcggtttaccaggtacaattgataacgatatcgttggtacagactat
acgatcggttaccaaacagcattagaaacggctgtggaagccattgaccgtttacgtgat
acttctacttcacatcagcgtatttcaatcgtagaaattatgggacgccattgtggcgat
ttaaccattagtgcagcgctggcaagtggttgtgaatatattatcgtgccggaaaaaggt
ttagataaagagtcattaatgcgcaatattgatgaaggctttaaaaaaggtaagcgtcat
gcaattattgcgattaccgagttaatgacggatgtgcatcagttagcaaaagaaattgaa
gagcgttttggtcacgaaacacgtgcaacagtattaggtcacatccaacgtggtggggcg
ccttgtccgtttgatcgtatcttagcgtcacgcatgggcgtatatgcggtagatttatta
ttgcaaggttatggtggtcgttgtgtcggtattcaaaatgagaaattagtacaccacgat
atcattgatgcaattaacaatatgcgtcgtccgttcaaagatgaattattcgatgcagct
agaaaattattctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system