KEGG   Actinobacillus suis H91-0380: ASU2_05965Help
Entry
ASU2_05965        CDS       T02262                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00010  Glycolysis / Gluconeogenesis
asi00030  Pentose phosphate pathway
asi00051  Fructose and mannose metabolism
asi00052  Galactose metabolism
asi00680  Methane metabolism
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01120  Microbial metabolism in diverse environments
asi01130  Biosynthesis of antibiotics
asi01200  Carbon metabolism
asi01230  Biosynthesis of amino acids
asi03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_05965
   00030 Pentose phosphate pathway
    ASU2_05965
   00051 Fructose and mannose metabolism
    ASU2_05965
   00052 Galactose metabolism
    ASU2_05965
  Energy metabolism
   00680 Methane metabolism
    ASU2_05965
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    ASU2_05965
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     ASU2_05965
Protein phosphatases and associated proteins [BR:asi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     ASU2_05965
Messenger RNA biogenesis [BR:asi03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     ASU2_05965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat NAD_kinase PGM_PMM_II
Motif
Other DBs
NCBI-ProteinID: AFU19331
UniProt: K0G4Q5
Position
complement(1320666..1321640)
Genome map
AA seq 324 aa AA seqDB search
MTKQIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGIQDGYYGLYNDKVIQLDRRS
VSETINRGGTFLGSARFPQFKDPEVRKQAVETLKKYEIDALVVIGGDGSYMGAKLLTEEF
GYPCIGLPGTIDNDIVGTDYTIGYQTALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALASGCEYIIVPEKGLDKESLMRNIDEGFKKGKRHAIIAITELMTDVHQLAKEIE
ERFGHETRATVLGHIQRGGAPCPFDRILASRMGVYAVDLLLQGYGGRCVGIQNEKLVHHD
IIDAINNMRRPFKDELFDAARKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaatcaaaaaaattgctgtgttaacgagtggtggtgatgcgcctggcatg
aatgctgcgattcgtggtgtcgttcgtgcagcactcaatgaaggtttagaggtatatggt
atccaagacggttattatggtttatataatgacaaagtcatccaattagatcgtcgttct
gtatcagagacaatcaaccgtggcggtacattcttaggttctgcgcgcttcccgcaattt
aaggatccggaagtgcgtaagcaagcagtggaaacactgaaaaaatatgaaattgatgca
ttggtggttatcggcggtgacggctcttacatgggcgcgaaactattaaccgaagagttt
ggttacccttgcatcggtttaccaggtacaattgataacgatatcgttggtacagactat
acgatcggttaccaaacagcattagaaacggctgtggaagccattgaccgtttacgtgat
acttctacttcacatcagcgtatttcaatcgtagaaattatgggacgccattgtggcgat
ttaaccattagtgcagcgctggcaagtggttgtgaatatattatcgtgccggaaaaaggt
ttagataaagagtcattaatgcgcaatattgatgaaggctttaaaaaaggtaagcgtcat
gcaattattgcgattaccgagttaatgacggatgtgcatcagttagcaaaagaaattgaa
gagcgttttggtcacgaaacacgtgcaacagtattaggtcacatccaacgtggtggggcg
ccttgtccgtttgatcgtatcttagcgtcacgcatgggcgtatatgcggtagatttatta
ttgcaaggttatggtggtcgttgtgtcggtattcaaaatgagaaattagtacaccacgat
atcattgatgcaattaacaatatgcgtcgtccgttcaaagatgaattattcgatgcagct
agaaaattattctaa

DBGET integrated database retrieval system