KEGG   Actinobacillus suis: ASU2_05965Help
Entry
ASU2_05965        CDS       T02262                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asi  Actinobacillus suis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:asi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:asi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asi00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:asi00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:asi00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:asi00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:asi00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1320666..1321640)
Genome map
AA seq 324 aa AA seqDB search
MTKQIKKIAVLTSGGDAPGMNAAIRGVVRAALNEGLEVYGIQDGYYGLYNDKVIQLDRRS
VSETINRGGTFLGSARFPQFKDPEVRKQAVETLKKYEIDALVVIGGDGSYMGAKLLTEEF
GYPCIGLPGTIDNDIVGTDYTIGYQTALETAVEAIDRLRDTSTSHQRISIVEIMGRHCGD
LTISAALASGCEYIIVPEKGLDKESLMRNIDEGFKKGKRHAIIAITELMTDVHQLAKEIE
ERFGHETRATVLGHIQRGGAPCPFDRILASRMGVYAVDLLLQGYGGRCVGIQNEKLVHHD
IIDAINNMRRPFKDELFDAARKLF
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgactaaacaaatcaaaaaaattgctgtgttaacgagtggtggtgatgcgcctggcatg
aatgctgcgattcgtggtgtcgttcgtgcagcactcaatgaaggtttagaggtatatggt
atccaagacggttattatggtttatataatgacaaagtcatccaattagatcgtcgttct
gtatcagagacaatcaaccgtggcggtacattcttaggttctgcgcgcttcccgcaattt
aaggatccggaagtgcgtaagcaagcagtggaaacactgaaaaaatatgaaattgatgca
ttggtggttatcggcggtgacggctcttacatgggcgcgaaactattaaccgaagagttt
ggttacccttgcatcggtttaccaggtacaattgataacgatatcgttggtacagactat
acgatcggttaccaaacagcattagaaacggctgtggaagccattgaccgtttacgtgat
acttctacttcacatcagcgtatttcaatcgtagaaattatgggacgccattgtggcgat
ttaaccattagtgcagcgctggcaagtggttgtgaatatattatcgtgccggaaaaaggt
ttagataaagagtcattaatgcgcaatattgatgaaggctttaaaaaaggtaagcgtcat
gcaattattgcgattaccgagttaatgacggatgtgcatcagttagcaaaagaaattgaa
gagcgttttggtcacgaaacacgtgcaacagtattaggtcacatccaacgtggtggggcg
ccttgtccgtttgatcgtatcttagcgtcacgcatgggcgtatatgcggtagatttatta
ttgcaaggttatggtggtcgttgtgtcggtattcaaaatgagaaattagtacaccacgat
atcattgatgcaattaacaatatgcgtcgtccgttcaaagatgaattattcgatgcagct
agaaaattattctaa

DBGET integrated database retrieval system