KEGG   Actinobacillus suis: ASU2_07285Help
Entry
ASU2_07285        CDS       T02262                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
asi  Actinobacillus suis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ASU2_07285
Enzymes [BR:asi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ASU2_07285
Exosome [BR:asi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ASU2_07285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1626832..1627851)
Genome map
AA seq 339 aa AA seqDB search
MAQYLNTSFPTRRMRRLRKHDFSRRLVAESQLTASDLIYPVFVIEGENQRVKVPSMPGVE
RLTIDQLLIEAGELVKYGVPLIALFPVVGDAKKSLMAEEAYNPEGLAQRAVRALKAAYPE
LGVMTDVALDPFTTHGQDGIIDEEGYVLNDITTEVLVKQALSHAEAGADIVAPSDMMDGR
IGKIREALEAKGLINTQIMAYSAKYASNYYGPFRDAVGSAGNLKGGNKFTYQVDPANANE
GLHEVAMDIQEGADMVMVKPGMPYLDMVWRVKENFGVPTFAYQVSGEYAMHMAAIQNGWL
KERECVMEGLLCFKRAGADGILTYFAKTVAKWLYEDNHQ
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggctcaatatcttaacacttcgtttcccactcgtcgtatgcgtcgcttacgtaaacac
gatttcagtcgccgtttagtggcggaaagtcaattgactgccagcgatttaatctatccg
gtatttgtgattgaaggtgaaaatcagcgagtaaaagtgccatcaatgccgggcgtggaa
cgcttgacgattgatcagcttttaattgaagcaggtgagttagtgaaatatggtgtgccg
ctaattgctctatttccggtagtgggtgatgcgaaaaaatcattgatggcggaagaagca
tacaatccggaaggtttggcacaacgtgctgtgcgtgcattaaaagcggcttatcctgaa
ttaggcgtgatgaccgatgtagcgttagatccgttcacgacacacggtcaagacggcatt
attgatgaagaaggctatgtgctgaatgacatcacaaccgaagtattagtaaaacaagcg
ctttctcacgcagaagcgggggcggatattgttgcaccaagcgatatgatggacggtcgt
atcggtaaaattcgtgaagcacttgaagcgaaaggcttaatcaatacgcaaattatggcg
tattcggctaaatatgcctcaaattattacggcccgttccgtgatgcggtcggttcggct
ggcaatttaaagggcggtaataaatttacttatcaagttgatccggcgaatgcgaacgaa
ggtttacacgaagtagcaatggatattcaagaaggggcggatatggtgatggtaaaaccg
gggatgccttatttggatatggtatggcgtgtaaaagaaaactttggcgtaccaactttt
gcttaccaagtgtctggtgaatacgcaatgcatatggcggcgattcagaatggttggcta
aaagaacgtgagtgtgtaatggaaggtttgctttgcttcaaacgtgcgggagcggatggt
atcttaacctatttcgctaaaacggtggcgaagtggttatacgaagataatcaccaataa

DBGET integrated database retrieval system