KEGG   Actinobacillus suis: ASU2_07405Help
Entry
ASU2_07405        CDS       T02262                                 

Definition
ethanol-active dehydrogenase/acetaldehyde-active reductase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
asi  Actinobacillus suis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    ASU2_07405
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_07405
  Lipid metabolism
   00071 Fatty acid degradation
    ASU2_07405
  Amino acid metabolism
   00350 Tyrosine metabolism
    ASU2_07405
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ASU2_07405
   00626 Naphthalene degradation
    ASU2_07405
Enzymes [BR:asi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ASU2_07405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1647623..1648660)
Genome map
AA seq 345 aa AA seqDB search
MRAAVVAPQCDGTVEIVERDIPEIKNGEALVEVEYCGVCHTDLHVAAGDYGKKPGRVLGH
EGIGIVKSIAPDVTNLKVGDRVSIAWMFESCGACEYCTTGRETLCRSVKNAGYTVDGGMA
THCVVTANYAVKVPDGLDPAQASSITCAGVTTYKGIKVSGVRAGQWIAIYGAGGLGNLAV
QYAKKVFGAHVIAIDINDDKLAFAKEVGADLTINPLKEDSAKVIQEKVGGAHAAVVTAVS
KVAFNAAVDCVRAGGRVVAIGLPPETMDLSIPRIVLDGIEIVGSLVGTRQDLAEAFQFGA
EGLVVPLVQLRRLDEANDIFQEMRDGKIQGRMVIDMKKGCGCGSH
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgctgctgtggttgccccacaatgtgatggaacagttgaaattgttgaacgagac
attcctgaaatcaaaaatggcgaagcccttgttgaagttgaatactgtggtgtatgtcat
accgatttacatgttgccgccggtgattatggtaaaaaaccgggacgtgtattaggccat
gagggcatcggtattgttaaatcgattgcaccggatgttaccaatttaaaagtgggtgat
cgtgtgagtattgcatggatgtttgaaagctgcggtgcttgtgaatattgtactaccgga
cgagaaacgctgtgccgtagtgtgaaaaatgccggttataccgtggatggcggtatggcg
actcactgtgttgtaaccgccaattatgcggttaaagtaccagatggtttagatccggcg
caagcaagcagtattacttgtgcgggtgtaacaacttacaaagggattaaagtatccggt
gtgcgtgcaggtcaatggattgcaatttatggtgccggtggtttaggcaacttggcggtg
caatatgcgaagaaagtattcggtgcgcatgtgattgcaattgatattaatgatgacaaa
ttagcgtttgccaaagaagtcggtgcggatttaaccattaatccgttaaaagaagacagt
gcgaaagttattcaagaaaaagtggggggcgcacacgccgcggtcgtgacagcagtatct
aaagtggcatttaatgcagcggtagattgtgtacgtgccggtggacgtgtggttgctatc
ggtcttccaccggaaacgatggatctttctattcctcgtattgtgttagacggcattgaa
attgtcggctcgttagtcggtactcgccaagatcttgccgaggcatttcaattcggtgcg
gaaggattagtcgtaccgttagtccaattacgccgtttggatgaggctaatgatattttc
caagaaatgcgagatggtaaaattcaaggtcgaatggtaattgatatgaaaaaaggttgt
ggctgcggtagtcattaa

DBGET integrated database retrieval system