KEGG   Actinobacillus suis H91-0380: ASU2_07545Help
Entry
ASU2_07545        CDS       T02262                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asi  Actinobacillus suis H91-0380
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    ASU2_07545 (tpiA)
   01230 Biosynthesis of amino acids
    ASU2_07545 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_07545 (tpiA)
   00051 Fructose and mannose metabolism
    ASU2_07545 (tpiA)
   00562 Inositol phosphate metabolism
    ASU2_07545 (tpiA)
Enzymes [BR:asi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     ASU2_07545 (tpiA)
Exosome [BR:asi04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   ASU2_07545 (tpiA)
  Exosomal proteins of bladder cancer cells
   ASU2_07545 (tpiA)
  Exosomal proteins of melanoma cells
   ASU2_07545 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1673509..1674279
Genome map
AA seq 256 aa AA seqDB search
MARRPLVMGNWKLNGSKAFTKELIAGLKAELADVKGCDVAIAPPVMYLAEAEAALAGQSV
IALGAQNVDVNVQGAFTGDISTEMLKDFGAKYIIIGHSERRTYHKESDEFIAKKFGALKA
AGLVPVLCIGETEAENEAGQTEAVCAKQIDAVIDALGVEAFNGAVIAYEPIWAIGTGKSA
TPAQAQAVHAFIRGHIAAKSQAVADQVIIQYGGSVNDANAAELFTQPDIDGALVGGASLK
APAFAVIVKAAEKAKA
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atggcacgtcgtccacttgtaatgggtaactggaaattaaacggtagcaaagcatttacg
aaagagttaattgccggcttaaaagcggaattagcggatgttaaaggctgtgatgttgca
atcgctccaccggtaatgtacttagcggaagcggaagctgcgttagcgggtcaatcagtg
attgcattaggcgcacaaaacgtagatgtaaatgtacaaggtgcatttacaggtgacatt
tcaacagaaatgttaaaagacttcggtgcaaaatatatcattatcggtcactctgagcgc
cgtacttaccacaaagaaagcgatgaatttattgcgaaaaaattcggtgcgttaaaagca
gcaggcttagtaccggtattatgtatcggtgaaaccgaagcggaaaacgaagcgggtcaa
actgaagcggtatgtgcaaaacaaattgatgcggtaattgatgcgttaggcgttgaagcg
ttcaacggtgcagtaatcgcatacgaaccaatctgggcaatcggtacaggtaaatctgca
actcctgctcaagcacaagcggttcacgcattcatccgtggtcacatcgcagctaaatca
caagcggttgcggatcaagttatcatccaatacggtggttctgtgaacgatgcaaacgct
gcggaattattcactcagccggatatcgacggtgcattagtcggcggcgcgtcattaaaa
gcacctgcatttgcggttatcgtaaaagcggcggaaaaagcgaaagcgtaa

DBGET integrated database retrieval system