KEGG   Actinobacillus suis: ASU2_08080Help
Entry
ASU2_08080        CDS       T02262                                 

Definition
xylose isomerase (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
asi  Actinobacillus suis
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:asi00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:asi00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1800042..1801361)
Genome map
AA seq 439 aa AA seqDB search
MSNYFDKIEKVKYEGANSTNPFAFKHYNPNEVILGKTMAEHLRLAVCYWHTFCWTGNDMF
GVGSLDRSWQKTGDLLEGAKQKAEIAFEFFQKLGIPYYCFHDVDIAPEGNSYKEYVHNFH
TMVDILEKKQAETGVKLLWGTANCFTNPRYMSGASTNPNPEVFSWAASQVFNAMNATKRL
GGENYVLWGGREGYETLLNTDLKREREQIGRFMQMVVEHKHKIGFNGTLLIEPKPQEPTK
HQYDYDVATVYGFLKQFGLEKEIKVNIEANHATLAGHTFQHEIATAAALDIFGSIDANRG
DPQLGWDTDQFPNSVEENTLVMYEILKAGGFTTGGFNFDAKIRRQSTDPYDLFHGHIGAI
DVLALSLKRATKMIEDQTLQGIVDQRYAGWNGDLGQQILAGKASLEDLAKIVESKALDPK
PVSGQQEYLENLVNNYIYR
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgtctaactatttcgataaaattgaaaaagtaaaatatgaaggtgctaactcaaccaat
ccttttgcttttaaacattacaatccgaacgaagtgattttaggcaaaaccatggcggaa
catttacgtttagcagtatgttattggcatactttctgctggacggggaatgatatgttc
ggtgtaggttctttagatcgtagttggcaaaaaacaggtgatttactcgaaggcgcaaaa
caaaaagcggaaattgcctttgaattcttccaaaaattagggattccttactattgcttc
cacgatgtagacattgcaccggaaggtaattcatataaagaatatgtacataatttccat
accatggtggatattcttgagaaaaaacaagcggaaaccggcgtgaaattattatggggt
acagcaaactgctttactaaccctcgttatatgtccggcgcatcaaccaatccgaatcct
gaagtgttctcttgggcagcatcgcaagtattcaatgcgatgaacgcaaccaaacgctta
ggcggtgagaactatgtgttatggggcggtcgtgaaggttatgaaactttattaaatacc
gatttaaaacgtgaacgtgaacaaatcggtcgctttatgcaaatggtggtggaacataaa
cataaaatcggctttaacggtacgttattaatcgaaccgaaaccgcaagaaccgactaaa
caccaatatgactatgacgtagcaacggtttacggcttcttaaaacaattcggtttagaa
aaagaaatcaaagtgaacattgaagcaaaccacgcaactttagctggtcatactttccaa
cacgaaattgcaactgcggcagcattagatatctttggttcgattgatgctaaccgcggc
gatccacaattaggttgggatacagaccaattcccgaacagcgtggaagaaaatacgctt
gtgatgtatgaaatcttaaaagcaggcggctttactaccggtggcttcaactttgatgcg
aaaatccgccgtcaaagtacagatccgtatgatttattccacggccatatcggtgcgatt
gacgtacttgccctttcattaaaacgtgcaacgaaaatgattgaagaccaaaccttacaa
ggtatcgttgatcaacgttacgcaggctggaacggcgatttaggtcagcaaattcttgcc
ggtaaagcaagccttgaagatttagcgaaaatcgttgaaagcaaagcacttgatccgaaa
ccggtttcaggtcagcaagaatacttagaaaatttagtgaataattatatttatcgttaa

DBGET integrated database retrieval system