KEGG   Actinobacillus suis: ASU2_08215Help
Entry
ASU2_08215        CDS       T02262                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
asi  Actinobacillus suis
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ASU2_08215
Enzymes [BR:asi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     ASU2_08215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1839174..1840643
Genome map
AA seq 489 aa AA seqDB search
MSNLKPFPANFLWGGATAANQIEGGFDADGKGLSAADMVAYVPKEERGAHSAAIEVTSER
IESILSGKFQGRFPKRDGIDFYHKYKDDIALFAEMGFKCFRISIHWARIFPNGYDEQPNE
AGLKYYDDMFDEMLKHGIQPMVTLCHYETPLGLVQKYNGWLHRDVIGHFLRYAETVFKRY
KDKVKYWLTFNEINMITMHSPYTGGGVVIDRIPEAERENAKYQALHHQFVASALATKLLH
EIIPDGKMGCMLARLHHYALTADPKDQRLAQWGNQQNLFFTDVHARGEYPRYMLRHWQEN
NVHIHKEFGDDAILKQYPVDFISFSYYMSVCVTTHDEGEKVGGNLIEGVKNPYLKASDWG
WQIDPEGLRITLNDMYDRYQKPLFIVENGLGAYDQVEADGSIHDHYRIDYLRAHIQQMQE
AISDGVELIGYLEWGPIDLVSMSTSEMSKRYGFIHVDLDDLGNGTGKRSRKDSFYWYKKV
IASNGTDLA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatttaaaaccgtttccagcgaattttttatggggtggcgcaacggctgccaat
caaattgaaggtggctttgatgcggatggtaaaggtttatccgctgcggatatggttgca
tacgtaccaaaagaagagcgtggtgcgcacagtgctgcgattgaagtgacttcagagcgt
atcgaatctattttatccggcaaattccaaggtcgcttccctaaacgagacggcattgat
ttctatcacaagtataaagacgatatcgccctctttgctgaaatgggctttaaatgcttc
cgtatctctattcattgggcaagaattttcccgaacggttatgatgaacagccgaatgaa
gcgggcctaaaatactatgacgatatgtttgatgaaatgctcaaacacggtattcaaccg
atggtgaccctttgtcactatgaaactccattaggtttggtgcaaaaatataacggttgg
ctacatcgtgacgttatcgggcatttcttacgctatgcggaaaccgtgtttaagcgttat
aaagacaaagtgaaatattggttaacgtttaatgaaatcaatatgatcactatgcatagc
ccttataccggtggcggcgtggttatagatcgtattcccgaagcggaacgtgaaaacgct
aaataccaagcgcttcatcatcaatttgtcgccagtgcgctcgcaaccaaattactgcac
gaaatcattccggacggcaaaatgggctgtatgctagcccgtttacatcactatgcgtta
accgccgatccgaaagaccaacgtctggcacaatggggtaatcagcaaaacttgttcttc
acagatgttcacgctcgtggtgagtacccacgttatatgttgcgccactggcaagaaaat
aacgtgcacattcacaaagaattcggagatgatgcgattctgaaacaatatccggtcgat
tttatttcctttagttactatatgtcggtttgtgttactacacacgacgaaggcgagaaa
gttggtggcaatctgattgaaggcgtgaaaaatccgtatcttaaagcctccgattggggt
tggcaaatcgatccggaagggttacgtattacattaaacgatatgtacgatcgttatcaa
aaaccgctcttcattgtcgaaaacgggctaggtgcctatgaccaagttgaagcggacgga
agcattcatgaccattatcgcatcgattatttacgtgcgcatatccaacaaatgcaagaa
gcaatttcagacggtgtggaattgatcggttatttggaatgggggccgattgatttggtg
agtatgtcgacttccgaaatgtcaaaacgctacggatttattcatgtcgatttggacgac
cttggcaacggcaccggcaaacgtagccgtaaagattcattctactggtacaaaaaagtt
atcgccagcaacggaactgatttagcataa

DBGET integrated database retrieval system