KEGG   Actinobacillus suis H91-0380: ASU2_08940Help
Entry
ASU2_08940        CDS       T02262                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
asi  Actinobacillus suis H91-0380
Pathway
asi00260  Glycine, serine and threonine metabolism
asi00750  Vitamin B6 metabolism
asi01100  Metabolic pathways
asi01110  Biosynthesis of secondary metabolites
asi01120  Microbial metabolism in diverse environments
asi01230  Biosynthesis of amino acids
Module
asi_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ASU2_08940
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ASU2_08940
Enzymes [BR:asi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ASU2_08940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: AFU19918
UniProt: K0G6S7
Position
1972288..1973568
Genome map
AA seq 426 aa AA seqDB search
MNLYNIKHPEEQVNFAQGVRQGLGKDQGLFFPEVLPKFDDIEALLDLPLVERSQKILTAL
IGEELPQETVNAMVKNAFTFPAPLTKVNDDIYALELFHGPTLAFKDFGGRFMAQALASVR
GDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPLQEKLFCTLGGNIRTVAI
ESDFDACQALVKQAFDDAELRQAIGLNSANSINISRLLAQVCYYFEAVAQLPKEKRSDVV
VSVPSGNFGNLTAGLIAKTLGLPIKRFIASTNANDTVPRYLKSGKWEPNATVATLSNAMD
VSRPNNWPRVEELFKRNGWALTDLGSAALNDAETEAALKTQYAEGYLCEPHGAIAYQVLK
DQLQAGETGIFLCTAHPAKFKESVERILEIELPLPEALDKHNKMELLSDTMPADFAKLRE
YLLAGN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaacttatacaacatcaaacatcccgaagaacaagttaattttgcacaaggcgtgcgc
caaggtttaggtaaagatcagggcttatttttccctgaagtgttaccaaaatttgacgat
atcgaggcgttactcgatttacctttagttgagcgcagtcaaaaaattcttacggcactg
attggtgaagagcttccgcaagaaacggtaaatgcgatggtaaaaaatgcgtttaccttc
ccggcaccgctcacaaaagtgaatgacgacatttatgcacttgagctgttccacggcccg
acattggcgtttaaagacttcggcggtcgttttatggcacaagcactggcaagcgtgcgt
ggtgacggcaaaattaccattttaaccgcaacctcaggcgacaccggcgcagcagttgca
cacgcattctacggtttagaaaatatcaatgtggtgatcctttatccaaaaggcaaaatc
agcccgttacaagaaaaattattctgtaccttaggtggtaacattcgtaccgttgcgatc
gaatcggactttgacgcttgccaagcgttagtaaaacaagcgtttgacgatgccgaatta
cgtcaagcgatcggcttaaactcagcaaactcaatcaatatcagccgtttattagcgcaa
gtttgttattattttgaagcggtagcgcaattaccgaaagaaaaacgttcagatgttgtg
gtttctgtgccaagcggtaacttcggtaacttaacagcaggtttaatcgcaaaaacctta
ggtttaccaatcaaacgttttatcgcatcaactaatgcgaacgacaccgtgccacgttat
ttaaaatcaggcaaatgggaaccgaatgcgacggttgcgaccctgtcaaatgcaatggac
gtaagccgcccgaacaactggccacgagtggaagaattatttaaacgcaacggctgggcg
ctaaccgatttaggttcggcggcattaaacgatgcggaaaccgaagcggcattaaaaaca
caatatgcggaaggttacttatgcgaaccgcacggtgcaatcgcttaccaagtgttaaaa
gatcagcttcaagcaggtgaaaccggtattttcctctgcaccgctcacccagcaaaattc
aaagaatcggtagagcgcattttagagatcgaattaccactaccggaagcgttagataaa
cacaataaaatggaattgttatctgacaccatgccggcagatttcgcaaaattacgtgaa
tatttattagcaggtaactaa

DBGET integrated database retrieval system