KEGG   Actinobacillus suis H91-0380: ASU2_09235Help
Entry
ASU2_09235        CDS       T02262                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
asi  Actinobacillus suis H91-0380
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ASU2_09235
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     ASU2_09235
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2034526..2035437)
Genome map
AA seq 303 aa AA seqDB search
MKKLCVLGSVNADHVIRVPYFPKAGETLKGGHYHIAYGGKGANQAVAAARVRDASLVDVD
FIACIGADDIGRAMKQAFVQDGINPEHIVEVADQMTGIAMIQVADSGENSIVISAGANAK
LDESVVAQHQATIESADCLLVQLETPLQAVEKALKIAKAHHTQVILNPAPAQPLSDEILA
NIDMITPNETETALLTGVQVVDEQTAKQAANVFHQKGIQTVLITLGSKGAFLSENGNGEI
IAGFKVTPVDTTAAGDTFNGALAVALLEGKSMRDAVMFAHKASSISVTRMGAQSSIPTRE
ELH
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactttgtgtgttgggcagcgtaaatgcggatcatgttattcgagtcccttat
ttcccaaaagcgggcgaaacgctgaaaggcggtcattatcatattgcttatggtggcaaa
ggggcgaaccaagcggtagcagcggctcgtgtgcgagatgcatcattagttgatgtagat
tttatcgcttgtatcggcgctgatgatattgggcgagcaatgaaacaagcgtttgtgcaa
gacggcattaatcccgaacacattgttgaagtggctgatcaaatgaccggcattgcgatg
attcaagtggcggattcaggcgaaaacagcattgtgatttccgccggtgcgaatgcaaag
ctagatgaaagcgtggtggcacaacatcaagccacgattgaaagtgcggattgcctactg
gttcagctagaaacgccgttacaagcggtcgaaaaagcgctaaaaattgcgaaagctcat
cacacccaagtgattttaaatccggcaccggcacagccgctctcggacgaaattttagcg
aatatcgatatgattaccccaaatgaaaccgaaactgccttactgacaggcgttcaagtg
gtcgatgaacaaaccgccaaacaagcggcgaatgtgttccatcaaaaaggtattcaaacc
gtgttaattactttgggatcgaaaggggcgtttttaagtgaaaacggcaacggcgaaatt
attgccggctttaaagtcacaccggtagacaccaccgccgccggcgatacctttaacggc
gcactggcggttgctttattagaaggcaagtctatgcgagatgcggtaatgttcgcccac
aaagcctcttcgatttcagtcacccgtatgggcgcacaaagttcgattcctactcgagag
gaattgcactaa

DBGET integrated database retrieval system