KEGG   Actinobacillus suis H91-0380: ASU2_10625Help
Entry
ASU2_10625        CDS       T02262                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
asi  Actinobacillus suis H91-0380
Brite
Enzymes [BR:asi01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     ASU2_10625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2325704..2327104
Genome map
AA seq 466 aa AA seqDB search
MKKYLLSALAVAGIGYFSLVGYAYWFDKEQAPKLLAAAGLPESHQAVASVMFENGCQYCH
TPNAELPAYSKLPIASQMMAADIEKGTRFFRFDRLIEGMKDPSKLSEADLAKLEQVIRND
EMPIAKYIHVHWGARPDAEQKKVILDWITAQRQAHFLPKAEGTDATRLVQPIPDQLATNP
HKVALGEGLYFDGRLSGDGSIQCRTCHQLTQGGVDNLPVSEGIHGLKGGINAPTVFNAAF
NKWQFWDGRAKTLADQAGGPPTNPVEMGSKTWDEILAKLSKDEDFMQRFLAVYPHLDQAN
VTDAIGEFEKTLITPNSAFDRFLKGDQNALTDVQKRGYEHFKNAKCDTCHTGTAMGGQSF
EYMGLYGDYFKDRGTELTEADHGRYAVTKDPSDMHRFKVPTLRNVALTAPYMHDASAKDL
KEAVRIMGIYQSNKQFSDTELNELVAFLESLTGEYKGKLLTNEKVK
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaatatttactttcagccttagctgttgctggcattggctatttttctctcgtg
ggatatgcgtattggttcgataaagaacaagcgcctaaattactggctgcagccggatta
ccggaatcacaccaagccgttgctagcgtgatgtttgaaaatggctgtcaatactgtcac
acaccgaatgcagaattacctgcttattcaaaattacctatcgcaagtcaaatgatggcg
gcggatattgaaaagggaactcgctttttccgtttcgatcgtttaattgaagggatgaaa
gatccaagcaagctttcggaagctgatttggctaagttggagcaagttattcgcaatgat
gaaatgccgattgcgaaatatatccatgttcactggggcgctcgtccggatgcggaacag
aagaaagtgattctagattggattactgcacagcgccaggcacacttcttaccaaaagca
gaaggcacagatgcaacgcgtttagttcaaccgattccagatcaattagcaaccaatcca
cataaagtggcactaggtgaggggctttattttgacggacgtttatcaggtgacggttca
atccagtgccgtacttgtcaccaattaacgcaaggcggggtggataatttaccggtgtcg
gaagggattcacggcttaaaaggcggtatcaatgcaccaaccgtatttaatgcggcattt
aataaatggcaattctgggatggtcgtgcgaaaacattagctgatcaagcgggcggtccg
ccaactaatccggttgagatggggtcaaaaacttgggatgagattttggctaagttgagc
aaagatgaagactttatgcaacgtttccttgcagtttatccacatcttgatcaagcaaat
gtgacagatgcgattggtgaatttgagaaaacgcttattacaccaaatagtgccttcgac
cgtttcttaaaaggtgatcaaaacgcattaactgacgtacaaaaacgtggttatgaacat
ttcaaaaatgcgaaatgtgacacctgtcatactggtacggcaatgggtggacaatcattt
gaatatatgggcttatacggcgactacttcaaagatcgtggtacggaattaacggaagcg
gatcacggtcgttatgcggtaactaaggatccaagcgatatgcaccgtttcaaagtgccg
actttacgtaacgtggcgttaaccgcaccatatatgcacgatgcaagcgcgaaagactta
aaagaagcggttcgtattatgggtatttaccaaagcaataaacagttctctgatacggag
cttaatgagttagttgctttcttagaatcactaaccggtgaatataaaggcaaattacta
actaatgaaaaagtgaaataa

DBGET integrated database retrieval system