KEGG   Actinobacillus suis: ASU2_11130Help
Entry
ASU2_11130        CDS       T02262                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
asi  Actinobacillus suis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:asi00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:asi00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:asi03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:asi03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:asi03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433831..2434253
Genome map
AA seq 140 aa AA seqDB search
MNRRDLLLNEMNIPQWMLTKPQVLKGDAQIRLDKAVKLVVVCEENHQASGLFSDILRTLQ
LQPNQYQWLDAEQAQRLAFEHQPIFWLIQAESQAVEIAKKFANQTAWQHSSWQDLTNVTT
KRQLWRQMAAFCQHFGDNHD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggcgagatttgctattaaatgagatgaatattcctcaatggatgctaacaaaa
ccgcaagtattaaagggcgatgcgcaaattcgcttggataaagcggtgaaactggttgtg
gtatgtgaagagaatcatcaagctagcggtctgttttcggatattttacgcaccttgcag
ctgcagccaaaccaatatcaatggttggatgcggaacaagcccagcgtttagcttttgaa
catcagcctattttttggttaatccaagcagaatcacaagcggttgaaattgcaaaaaaa
tttgcaaatcagaccgcttggcaacatagctcgtggcaagatttaactaatgtcacaact
aaacgccaactttggcgacaaatggcggcattttgtcagcattttggggataatcatgat
tga

DBGET integrated database retrieval system