KEGG   Actinobacillus suis: ASU2_11130Help
Entry
ASU2_11130        CDS       T02262                                 

Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
asi  Actinobacillus suis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:asi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    ASU2_11130
   00240 Pyrimidine metabolism
    ASU2_11130
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    ASU2_11130
   03430 Mismatch repair
    ASU2_11130
   03440 Homologous recombination
    ASU2_11130
Enzymes [BR:asi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     ASU2_11130
DNA replication proteins [BR:asi03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     ASU2_11130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2433831..2434253
Genome map
AA seq 140 aa AA seqDB search
MNRRDLLLNEMNIPQWMLTKPQVLKGDAQIRLDKAVKLVVVCEENHQASGLFSDILRTLQ
LQPNQYQWLDAEQAQRLAFEHQPIFWLIQAESQAVEIAKKFANQTAWQHSSWQDLTNVTT
KRQLWRQMAAFCQHFGDNHD
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaatcggcgagatttgctattaaatgagatgaatattcctcaatggatgctaacaaaa
ccgcaagtattaaagggcgatgcgcaaattcgcttggataaagcggtgaaactggttgtg
gtatgtgaagagaatcatcaagctagcggtctgttttcggatattttacgcaccttgcag
ctgcagccaaaccaatatcaatggttggatgcggaacaagcccagcgtttagcttttgaa
catcagcctattttttggttaatccaagcagaatcacaagcggttgaaattgcaaaaaaa
tttgcaaatcagaccgcttggcaacatagctcgtggcaagatttaactaatgtcacaact
aaacgccaactttggcgacaaatggcggcattttgtcagcattttggggataatcatgat
tga

DBGET integrated database retrieval system