KEGG   Aequorivita sublithincola: Aeqsu_0057Help
Entry
Aeqsu_0057        CDS       T02132                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
asl  Aequorivita sublithincola
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aeqsu_0057
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aeqsu_0057
   00640 Propanoate metabolism
    Aeqsu_0057
   00660 C5-Branched dibasic acid metabolism
    Aeqsu_0057
Enzymes [BR:asl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Aeqsu_0057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
65989..67179
Genome map
AA seq 396 aa AA seqDB search
MNLHEYQGKEILNSFGVEIQRGIVATTPKEAVEAAKKLTETTGTGWHVIKAQVHAGGRGK
GGGVKLAKNLQEVETIAGNIIGMDLVTPQTSAEGKRVHQVLVTEDVYYPGDSEPEEYYMS
VLLNRSTGRNMIMYSTEGGMDIETVAEETPHLIFTEEVDPAVGLLGFQARRVAFNLGLSG
KAFKEMTKFVTALYKAYNESDSSLFEINPVLKTSDDRIIAVDAKVSIDDNALFRHKDYME
MRDKREENPVEVEAQEKGLNYVDLDGNVGCMVNGAGLAMATMDLIKQAGGEPANFLDVGG
TANAERVEAAFKLILKDPNVKAILVNIFGGIVRCDRVAQGIIDAYKNMGTINVPIIVRLQ
GTNADVAKKMIDDSGLDVQSAIEFQEAADKVKAVLA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacacgaataccaaggaaaagaaatcttaaacagttttggcgttgaaatacaa
cgcggcatcgtggcaactactccaaaagaggcagtagaagccgcaaaaaaacttacagaa
acaaccggaacgggctggcacgtaattaaggctcaagttcacgcaggtggtcgtggtaaa
ggtggtggtgtaaaacttgcgaagaacttacaagaagttgaaacgattgcaggaaacatc
attgggatggatcttgtaactccacaaacttctgctgaagggaaacgagttcatcaagtt
ttggttactgaagatgtttattaccctggtgatagcgagccagaagaatattatatgagt
gttcttttaaaccgctctacaggaagaaacatgattatgtattctaccgaaggtggaatg
gatattgaaaccgttgctgaagaaactccgcatttaatttttactgaagaagttgatcca
gctgttggccttttgggctttcaagctagaagagtcgctttcaaccttggattgagcggc
aaagcctttaaggaaatgacaaaatttgttactgcactttacaaagcatataatgaatct
gattcttctcttttcgaaataaatcctgttttaaaaacaagtgacgatagaattattgcg
gttgatgctaaagtgagtattgacgacaatgcacttttccgtcataaagattatatggaa
atgcgcgacaaacgcgaggaaaatcctgtagaagttgaagcacaagaaaaaggactaaac
tatgtggatcttgacggaaacgttggttgtatggttaatggcgccggacttgcaatggca
acaatggatcttattaagcaagctggtggtgagcctgcaaactttcttgacgtaggtgga
actgcaaatgctgagcgagttgaagctgctttcaaattaattttgaaagacccgaacgta
aaagcaattttggtaaatatttttggtggaatcgtacgttgcgaccgtgtggcacaagga
attattgacgcttataaaaatatgggaactatcaatgtgcctatcattgtgcgtttacaa
ggaacaaatgcagatgttgcaaagaaaatgattgatgacagcggattggatgttcaaagt
gcgattgaatttcaagaagctgcagataaagtgaaagctgtattggcctaa

DBGET integrated database retrieval system