KEGG   Aequorivita sublithincola: Aeqsu_0420Help
Entry
Aeqsu_0420        CDS       T02132                                 

Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asl  Aequorivita sublithincola
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aeqsu_0420
   01230 Biosynthesis of amino acids
    Aeqsu_0420
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aeqsu_0420
   00051 Fructose and mannose metabolism
    Aeqsu_0420
   00562 Inositol phosphate metabolism
    Aeqsu_0420
Enzymes [BR:asl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Aeqsu_0420
Exosome [BR:asl04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Aeqsu_0420
  Exosomal proteins of bladder cancer cells
   Aeqsu_0420
  Exosomal proteins of melanoma cells
   Aeqsu_0420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(415286..416035)
Genome map
AA seq 249 aa AA seqDB search
MRKKIVAGNWKMNNDLAETELFLVELKKQVFPENVIVMIAPPFTSLNQAFKSLHEHPVTV
VAQNMHQSKEGAFTGEISAKMLKSVGVETVIVGHSERRAFFNEDSAVLAEKVNTALENEM
TVIFCIGEEIYDRKNGNHFELIKKQLMEGLFHVSDKSWENLVIAYEPVWAIGTGETATPE
QAQEMHKFIRKTIAENYSKNIAINVSILYGGSVKPDNATEIFGQADVDGGLIGGAALKVE
SFMNIVNSF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaaaaatagtagcaggaaactggaaaatgaacaatgatttggccgaaaccgag
ctatttctggtcgaactgaaaaagcaggttttcccagaaaatgtaatcgtaatgattgcg
ccgccatttaccagtttaaatcaggcattcaaatcgttacatgagcatccagtaacggtt
gtagctcaaaatatgcaccaaagcaaggaaggtgcttttacaggagagatttctgctaaa
atgctaaaaagtgttggagtcgaaaccgttattgtaggccatagtgaacgccgcgctttt
tttaatgaagatagcgctgttcttgcagaaaaagtgaataccgcactcgaaaatgagatg
accgttattttctgcataggtgaagagatttatgatagaaaaaacggaaaccattttgaa
ctaataaaaaagcaactaatggaaggacttttccacgtatcagataaatcttgggaaaac
ttagttattgcttatgagccagtttgggcaattggaaccggcgaaacagcaacccccgag
caagcgcaggaaatgcacaaattcatccggaaaactattgcggaaaactattcaaagaat
attgccattaacgtttcaatcctttacggcggaagtgtaaagccagataatgcgactgaa
attttcggacaagctgacgttgacggaggccttattggaggagctgcgctaaaggtggaa
agttttatgaatattgtaaattctttttaa

DBGET integrated database retrieval system