KEGG   Aequorivita sublithincola: Aeqsu_0425Help
Entry
Aeqsu_0425        CDS       T02132                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
asl  Aequorivita sublithincola
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:asl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
420101..420937
Genome map
AA seq 278 aa AA seqDB search
MQTLNCRGNLIDLSVPKVMGIINVTSDSFYDGGKTFSDKNILKQAEEMLSEGATFLDIGG
YSTRPNADEISESEEIRRVVEAVEIILKNFPEALISVDTFRSEVAKKAVEAGAAMVNDVS
GGILDSEMFKTVAKLKVPYILMHTRGTPKTMTKLTDYKNVTMEVLKDLAEKIALARAEGI
NNIIADPGFGFAKTREQSFQLLSNLELFQSLDVPILAGVSRKSFIYKTLETSVGNALNGT
TSLNTIALLKGASILRVHDVKEAVECVKLWCEISGIRD
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
ttgcagacccttaattgccgcggcaaccttatagacctttctgtcccaaaagtgatgggc
attattaatgttacgtccgattcattttatgacggtggaaaaactttttctgataaaaat
attttgaagcaagctgaagaaatgctttccgagggcgctacatttctagatattggcggt
tatagcacaagaccgaatgctgatgaaatttctgaaagtgaagaaattagaagagttgtt
gaagccgtagaaattattttgaagaattttcccgaagcattaatttctgtggacaccttt
agaagtgaagttgcaaaaaaagctgtggaagctggcgctgcgatggtaaacgatgtttcg
ggcggaattctagattctgaaatgttcaaaaccgttgcaaaacttaaagtcccgtacatt
ttgatgcatacgcgaggaactcccaaaacaatgacgaaactcaccgattacaaaaacgta
acgatggaagttttaaaggatttagctgaaaaaatcgcactcgccagagcagaaggaatc
aacaatattattgcagatccaggttttggttttgcaaaaacacgcgaacaaagttttcaa
cttttgagtaatcttgaactttttcaaagtctggatgtacctattttagctggcgtttcg
cgaaaatcctttatttataaaacattggaaacttcagtaggaaatgctttgaatggcacc
acttcacttaacacaattgctcttttgaaaggtgcttcaattttaagagttcacgacgtt
aaggaagccgtggaatgtgtaaaactatggtgtgagattagcggaattagggattag

DBGET integrated database retrieval system