KEGG   Aequorivita sublithincola: Aeqsu_0646Help
Entry
Aeqsu_0646        CDS       T02132                                 

Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
asl  Aequorivita sublithincola
Pathway
asl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
asl01130  Biosynthesis of antibiotics
asl01230  Biosynthesis of amino acids
Module
asl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aeqsu_0646
Enzymes [BR:asl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Aeqsu_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: AFL80155
UniProt: I3YT37
Position
643296..644078
Genome map
AA seq 260 aa AA seqDB search
MTILEKITAYKLKEVAAKRETIPTRLLEKFPLFAKETKSLAEALRISTTGIIAEHKRRSP
SKSVINDKVLLHEVVSGYELAGAKGISVLTDSNFFGGSLDDLLLAEKTVSIPILRKEFIV
DPYQIYEAKAFGADTILLIAACLSAEELKQFSHLAKSLRLDVLLEVHNLEELQKSLLPNV
DMIGVNNRNLKNFKVNIETSKKLSAEIPHDFVKISESGISDVETIKDLRTYGFEGFLIGE
NFMKTENPGETAKAFIEKLR
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgacaatcttagaaaaaataacagcctacaaactaaaagaagttgccgcgaaaagagaa
acaattccaacccgtttgttggaaaaatttccactctttgcaaaagaaacaaaatctttg
gcggaagcgttgcgaatttcaaccacaggaattattgccgaacacaagcgccgttcgccc
agcaaatcggtaataaacgacaaagtcttgttgcacgaagtagtttcaggctacgaactt
gctggggcaaaagggatttcagttttaacggattctaacttttttggcggctctttggac
gatcttttgttagctgaaaaaacagtttcaatccctattctgcgcaaggaatttatagtt
gatccctatcaaatatacgaagccaaagctttcggcgcagatactattttgctgattgca
gcttgcctttccgcggaagaattaaaacagttttctcatttggccaaaagcttaagacta
gacgttttgctcgaagttcacaatcttgaagaacttcaaaaatcacttttaccaaatgta
gatatgattggtgttaacaacagaaatctgaaaaatttcaaagtaaatattgaaaccagt
aaaaaactgtcagcagagattccgcatgattttgtgaaaatttctgaaagtggaatcagc
gatgtagaaaccataaaagatttaagaacttatggttttgaaggatttttaataggtgaa
aatttcatgaaaaccgaaaatcctggtgaaacagctaaagcatttatagagaaattgaga
tga

DBGET integrated database retrieval system