KEGG   Aequorivita sublithincola: Aeqsu_0648Help
Entry
Aeqsu_0648        CDS       T02132                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
asl  Aequorivita sublithincola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aeqsu_0648
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aeqsu_0648
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aeqsu_0648
Enzymes [BR:asl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aeqsu_0648
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
644685..645866
Genome map
AA seq 393 aa AA seqDB search
MNYNVNEKGYYGEFGGAYIPEMLYPNVEELRQNYLKVMAEESFQKEFQQLLKEYVGRPTP
LYFAKRLSEKYNTKIYLKREDLCHTGAHKVNNTIGQILMAQRLGKTRIIAETGAGQHGVA
TATVCALMGLECIVFMGEVDIKRQAPNVARMKMLGAKVVPATSGSKTLKDATNEAIRDWI
NNPLDTHYIIGSVVGPHPYPDMVARFQSVISEEIKMQLKEKLGRENPDFVVACVGGGSNA
AGAFYHYLDKPEVGIIAVEAAGKGIDSGESAATSALGKVGIIHGSKTLLMQTNDGQITEP
YSISAGLDYPGVGPMHANLFASGRGEFISITDVEAMKAGLELCKLEGIIPAIESSHALAI
FENRKFKKDDVVVVNLSGRGDKDLDTYIKYFNL
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaattataacgtaaacgaaaaaggctattacggcgagtttggtggcgcatacattcca
gaaatgttgtatcccaatgtggaagaacttcgtcagaattatttaaaagttatggctgag
gaatcttttcaaaaagaatttcagcaattgctaaaagaatatgtgggtcgccctactccg
ctctattttgcgaagcggctttcagaaaaatacaacacaaaaatctatttaaaacgtgaa
gatctttgccatacaggtgctcataaagtaaacaataccatcggccagattttaatggcc
caacgtttgggcaaaactcgcattattgctgaaactggcgcaggacaacacggtgttgca
acagccacagtttgcgcactaatgggtttggagtgtatcgtttttatgggagaagttgat
attaaacgtcaagcgcccaatgttgctcgaatgaaaatgctcggcgcaaaagtagttccc
gcaacaagcggaagtaaaactttaaaagacgcgactaatgaagccattcgcgattggatc
aataatcctctggacacacattatattataggtagcgtggttggtccgcatccgtatcca
gatatggttgcgcgttttcaaagtgtgatttctgaagaaataaaaatgcaactcaaagaa
aagttaggtcgtgaaaacccagattttgttgttgcctgtgttggcggaggcagtaatgct
gcaggagctttttatcattatttagacaaaccagaagttggaattatcgcagtggaagct
gctggaaaaggaattgatagtggcgaaagcgctgcaacttcagccttaggaaaagttgga
attattcacggtagtaaaaccttgttgatgcaaacgaatgatgggcaaattacagaacct
tactctatttccgcaggtttagattatcctggagttggcccaatgcacgccaatcttttt
gcttcgggtcgtggggaatttatttcaataaccgatgtagaagcgatgaaagcaggtctt
gaactttgtaaattggaaggaattattcccgccattgaaagcagtcatgcgctcgccatt
tttgagaatagaaaattcaaaaaagacgatgtggttgttgtgaatttaagcggtcgtgga
gataaagatttagatacttatataaaatatttcaatttataa

DBGET integrated database retrieval system