KEGG   Aequorivita sublithincola: Aeqsu_0649Help
Entry
Aeqsu_0649        CDS       T02132                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
asl  Aequorivita sublithincola
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Aeqsu_0649
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Aeqsu_0649
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Aeqsu_0649
Enzymes [BR:asl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Aeqsu_0649
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
645924..646691
Genome map
AA seq 255 aa AA seqDB search
MNRIQEKLSENKKLLSIYFTAGYPKLDDTVEILQQLEKNGVDMVEIGLPFSDPLADGPTI
QASSQVALKNGMTTELLFQQLKDVRKTVSIPLIIMGYFNPVLQFGVENFCKKCAEVGIDG
LILPDLPLAEYEEHYSEIFKKYGLMNIFLITPQTYEERIRQIDNASEGFIYMVSSASVTG
SSSGFGNAQEDYFKRIATLSLKNPQIVGFGINNSETFQQATKHAKGAIIGSAFIKMLSDK
GLGEISNFLNAIRKV
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaatagaattcaagaaaaactttcagaaaataaaaagcttctttccatttacttcacc
gctggttatccaaaacttgacgatacagttgaaatacttcagcaattagaaaaaaacggc
gtagatatggttgaaatcggtttgccgttcagtgatcctttggcagatggacccactatt
caagcaagttcgcaagtggctttgaaaaatgggatgactacagaattactttttcagcaa
ttgaaagatgttcgaaaaacggtttcaatcccgctaataatcatggggtatttcaatcca
gtgcttcagtttggggttgaaaatttctgtaaaaaatgtgcagaagttggtattgacggc
ttgattcttccagatcttccattggctgaatatgaagaacattattccgaaatcttcaaa
aaatatggcttaatgaatatctttttaatcacgccacaaacttacgaagaacgaattcgg
caaattgataatgcttccgaaggatttatttatatggttagtagcgccagtgttactgga
agttcatcaggctttggaaatgcacaagaagattattttaaaagaattgctacgctttcg
cttaaaaatcctcagattgttggcttcggaataaataattctgaaacttttcagcaagct
acaaaacatgcaaaaggagcaatcataggtagcgcatttataaaaatgctttcagacaaa
ggcttgggtgaaatttcgaatttcttaaacgcgatcagaaaggtttaa

DBGET integrated database retrieval system