KEGG   Aequorivita sublithincola: Aeqsu_0821Help
Entry
Aeqsu_0821        CDS       T02132                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
asl  Aequorivita sublithincola
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Aeqsu_0821
Enzymes [BR:asl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Aeqsu_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(835024..835959)
Genome map
AA seq 311 aa AA seqDB search
MSTKTYAGIPQKYAALETSKIVLIPVPYDGTSTWQKGADKGPEAFLDASENMELYDIETQ
TEVYKQGVYLADAITENSTPEAMVSEVHKATKDYIKRNKFVTIFGGEHSISIGTIRAFNE
CFDNLTVLHIDAHADLRKDFHGSTCNHACAVYEASQTTNLIQIGIRSMDIAETRVMDEEK
VFFAHDMAKDEYWMDKVIEALGDNVFITFDLDAFDPSILPSTGTPEPGGLFWYETLDFLK
QVFEERNVVGFDIVELCPNENERASDFVAAKLYYKMLTYKFAGTEEGDEYENNFNETKKG
VSKFNTEEDEY
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcactaagacatacgccggaatcccgcaaaaatatgcggcccttgaaacatcaaaa
attgtattgatcccagttccgtatgacggaacaagcacatggcaaaagggagcagacaaa
ggtcctgaagcctttttagacgcttcagaaaacatggaattgtatgatatcgagacccaa
acagaggtatataaacaaggtgtttacctagccgatgctattactgaaaattccacacca
gaagctatggtttcagaagtgcataaagccacaaaagattatataaagcgaaataaattc
gtgacaatttttggtggcgaacacagcatttctataggaactattcgcgcttttaacgaa
tgttttgataacttaaccgtgcttcatattgatgcacatgcagatttgcgcaaggatttc
cacggaagcacttgcaaccacgcttgcgcagtttatgaggcaagccagaccacaaattta
atacaaataggtattcgaagtatggatattgctgaaactcgcgtgatggatgaagaaaaa
gtattcttcgcccatgacatggcaaaagacgaatactggatggataaagttattgaagct
ttgggtgacaatgttttcataacatttgaccttgatgcatttgatccgtcgatccttcca
tctactggaactccagagccaggcggacttttttggtatgaaactttagattttctaaaa
caagtttttgaagaaagaaacgtagtaggttttgatatagttgagctttgtccaaatgaa
aacgaaagagcgtcagactttgtagcagcaaaactttactacaaaatgttaacttataaa
ttcgctggaactgaagagggcgacgaatacgaaaacaattttaacgaaaccaaaaaaggc
gtttcaaaatttaatacagaagaagatgagtactag

DBGET integrated database retrieval system