KEGG   Aequorivita sublithincola: Aeqsu_0887Help
Entry
Aeqsu_0887        CDS       T02132                                 

Definition
Holliday junction DNA helicase subunit RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
asl  Aequorivita sublithincola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aeqsu_0887
Enzymes [BR:asl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Aeqsu_0887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(917604..918185)
Genome map
AA seq 193 aa AA seqDB search
MITHIQGRLVEKNPTDVVIDCNGVGYYINISLHTFSELPKSENVKLFTHLLVREDSHTLY
GFSSVAEREIFKLLISVSGVGASIARTMLSSLAPEQVLDAIANNDIPTIQSVKGIGAKTA
QRVVLDLKDKILKVYGLSSISAGTSNTNKNEALSALETLGFVRKQSEKVVDTIVRENPDA
SAEMIIKQALKNL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgataacccatatacagggcagactggttgaaaaaaacccaacagatgtagtgatagat
tgcaatggagtagggtactatatcaatatttctttgcacacattttccgaacttcctaag
agtgaaaatgttaaattattcactcatttgcttgttcgggaagatagccataccctatac
ggtttttcaagtgttgcggaacgtgaaatatttaaattactgattagtgtttctggagta
ggagctagcatagctagaacgatgttatcatcgttagcgccagaacaagttttggatgcc
attgcaaacaatgatataccaacaatccaatcagtaaaaggaatcggagccaagaccgcc
caacgtgtggttttggatttaaaagataagattttgaaagtgtacggtttgtcgtcaatt
tctgctggaacaagcaatacgaacaaaaatgaagcgttatctgctttggagacgctaggc
tttgttcgcaaacagtctgagaaagtggtggataccattgtgagagaaaacccagatgct
tccgcagaaatgatcattaaacaagctttaaaaaatttataa

DBGET integrated database retrieval system