KEGG   Aequorivita sublithincola: Aeqsu_1088Help
Entry
Aeqsu_1088        CDS       T02132                                 

Definition
N-acetyl-beta-hexosaminidase
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
asl  Aequorivita sublithincola
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Aeqsu_1088
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Aeqsu_1088
Enzymes [BR:asl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Aeqsu_1088
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1156692..1158977)
Genome map
AA seq 761 aa AA seqDB search
MRNILAVILTLYCINVFSQNTEVELIPKPQSIELKTGTFTIDKKTTIYFESEFEIAGNFL
NDFLQNGAGFSLKKASEKKADIIFKNDASQPSEGYFLDISDSKIVIKASDASGAFYAVQT
LRQLLPPQLEAKDSTKEQSFTVPQLMITDFPKFQYRGMHLDVSRHFFDKEFVKKYIANLA
LLKMNRFHWHLTDDQGWRIEIKKYPELTKKGAFREETLIGHYEDKPQLYDGKRYGGFYTQ
EEIKEVVAFAATQNITIIPEIEMPGHAQAAIHSYPELGCTGEQIPVATTWGVFEDIFCPK
EETFTFLENVLSEVMPLFPGEYIHIGGDEALKLRWKNCAHCQQLIQDKNLVDEHGLQSYF
IHRIEEFVNSKGKKIIGWDEILEGGLAPNATVMSWRGLQGGIDAAKQNHDVIMTPVSHCY
FDYYQSENLDEPTAIGGFLPLKKVYSFNPIPAELNQEQAKHILGAQGNLWTEYIPTEKQV
EYMVFPRILAMSEVDWSGPSKNFEKDYPDFFSRVEGFMKRLDALDINYANYLYEIEGEIL
KENGQVFYELSTPTKGKQIHYSINNSEIQVYSKPILIEKDSKITANVFKEDEKLGRDFSE
EIKYHKGITAEISINIPPNPAYAAGGKEALINGISGSNKRYGDKEWLGFWGDDLEITIDL
GKDTEIHSLETRFFNSPGVWIYSPKELSVSCKNSEGKEITYSKEILVEDSNKIDVIVDLL
ETKSFKTRFIKLKIPNYGMIPDGLQGAGHKAWTFIDEIIIK
NT seq 2286 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaatattttagccgtaatcctcacattatattgcatcaacgttttttcacaaaac
acagaagtggaattaattccaaaaccgcaatctatcgaattgaaaactggaacgttcaca
attgataaaaagacaaccatctattttgaatcagaattcgaaattgcaggaaatttttta
aatgattttcttcagaatggcgctggattttcacttaaaaaggcttcagaaaaaaaagca
gatataatttttaaaaacgatgcttcacaaccttctgaaggctattttttagatatttca
gattcaaaaattgtgataaaagcttcggatgcgagcggtgctttttatgcggttcaaact
ttacggcaattgcttccaccgcaacttgaggcaaaggattcaacaaaagaacaatctttt
acagtgccacaattgatgattaccgatttcccgaaatttcaatatcgcggaatgcatttg
gatgtgtcccgacattttttcgacaaggaatttgtaaaaaaatacatcgccaatctcgca
ttgctaaaaatgaatcgttttcattggcaccttaccgacgatcaaggttggcgcatcgaa
attaaaaaatatcccgaactcaccaaaaaaggtgcatttcgagaagaaacgctcattggc
cattatgaagacaaaccacaactttatgacggcaaacgctatggcggattttatacgcag
gaagagataaaggaagttgttgctttcgcagcaacgcaaaatattacaatcattcccgaa
attgaaatgcccggtcacgcgcaagccgcgattcattcttacccagaattgggttgcact
ggagagcaaattccagttgccacaacttggggcgtttttgaagatattttctgtccgaaa
gaagaaacatttacttttttagaaaatgttttaagtgaagtaatgccgctttttccaggc
gaatatattcatattggcggcgatgaagctctaaaactgcgctggaagaattgtgcgcat
tgtcaacaattaatacaagataagaacttagtggatgaacacggtttgcaaagttatttc
atccatagaattgaagagtttgtaaatagcaaaggcaaaaaaataataggttgggacgag
attttagaaggtggtctcgcaccaaatgcaacggtaatgtcgtggcgtggattgcaaggt
ggaattgatgccgcaaaacaaaatcacgatgtaattatgacgccagtttcgcactgctat
tttgattattaccaaagtgaaaatttggatgaacctacagctattggcggttttctacct
ttaaaaaaagtgtattcttttaatccgattccggcagaattaaaccaagagcaggctaaa
catattctcggagcccaaggcaatttatggacggaatacatccctacggaaaaacaagtg
gaatacatggttttcccaagaatccttgcaatgagtgaggtagattggagtggtccgtca
aaaaatttcgaaaaagattacccagatttcttttcaagagtagaaggttttatgaaacgt
ttggatgcgttggatataaattatgccaactatttgtatgaaattgaaggtgagatttta
aaagagaatggtcaagttttttacgaattatctacacccacaaaaggaaagcaaattcac
tactcaataaataattctgaaattcaagtttattcgaaacctattttaattgaaaaagat
tcgaaaattactgcaaatgtatttaaggaagatgagaaattaggtcgtgatttttccgaa
gaaataaaatatcacaaaggaattactgcagaaatttcaataaatataccgccaaatcca
gcgtatgctgctggcggaaaggaagctttgattaatggaatttctggcagtaacaaacgc
tacggcgataaagagtggttgggtttttggggcgatgatttggaaattactattgatttg
ggaaaagatacagaaatccattctttagaaacgagattctttaattctccaggagtttgg
atttattctcctaaggaactttctgtttcttgtaaaaattcggaagggaaagagattact
tattcaaaagaaatattagttgaggacagtaataaaattgatgttattgttgatttattg
gaaaccaaatcattcaaaacgagatttataaaattgaaaatccccaactacggaatgatt
ccagacggtttacaaggtgctggccataaagcttggacatttatcgacgaaataattata
aaatga

DBGET integrated database retrieval system