KEGG   Aequorivita sublithincola: Aeqsu_1436Help
Entry
Aeqsu_1436        CDS       T02132                                 

Definition
2-oxoglutarate dehydrogenase complex dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
asl  Aequorivita sublithincola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aeqsu_1436
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aeqsu_1436
  Amino acid metabolism
   00310 Lysine degradation
    Aeqsu_1436
Enzymes [BR:asl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Aeqsu_1436
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1538135..1539397
Genome map
AA seq 420 aa AA seqDB search
MALEMKVPSPGESITEVEIASWLVKDGDYVEKDQAIAEVDSDKATLELPAEASGIITLKA
EEGDVVAVGEVVCVIDTDAKKPGGDDSSEKAEEKPKEKNEEEAPKKAEAKTQTPSKSSTP
NQEQDKKTYATGTPSPAAKKILDEKGVSSKEVKGSGRDGRITKDDAANATPSMGTPGNGS
RGSERKKLSMLRRKVAERLVSAKNETAMLTTFNEVNMTAIFELRSQYKEQFKEKHGVGLG
FMSFFTLAVVRALELYPDVNSMIDGDYMITYDFKDISIAVSGPKGLMVPVIRNAENLSFR
GVEDEVKRLAIRARDGQITVDEMTGGTFTISNGGVFGSMLSTPIINPPQSAILGMHNIVE
RAIVRDGGIVVAPVMYVALSYDHRIIDGRESVGFLVAIKEALESPEELLMNNNVKRALEL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggcattagaaatgaaagtcccgtctccgggagaatccatcaccgaagttgaaatagcg
tcttggttagtaaaagatggcgattatgttgagaaagaccaagcaattgctgaagtagat
agcgataaagcaaccctagaacttccagcagaagctagtggaatcataactttaaaagct
gaagaaggcgatgttgttgccgtgggcgaagtagtttgcgttattgatacagatgccaaa
aaaccaggcggcgatgattcttcagaaaaagccgaagaaaaacctaaagagaagaatgag
gaagaagctcccaaaaaagctgaagccaaaacacaaactccttcaaaatcttcaactcca
aatcaggagcaggataaaaaaacgtatgccacaggtacaccttcaccagccgcaaagaaa
attcttgatgaaaagggagtgtcttcaaaagaagtaaaaggtagtggtcgcgatggtcgt
ataacaaaagacgatgccgcaaacgcaactccttcaatgggaactccaggaaatggtagt
cgcggtagtgaacgcaaaaaactttctatgcttcgtagaaaagtcgctgaacgtttagtt
tctgcaaaaaatgaaactgcgatgcttactacttttaatgaagtaaatatgaccgccatt
tttgaattgagaagtcaatacaaagaacaatttaaagaaaaacacggtgttggtcttggt
tttatgtctttcttcaccttagctgtagttcgcgcgttggaactttatccagatgtaaac
tctatgattgatggagattatatgattacttatgactttaaagacatttctattgctgtt
tctggaccgaaaggtttgatggttcctgtaattcgaaatgctgaaaacctaagctttaga
ggggttgaggatgaagtgaaacgtctagcaataagagctcgcgacggacaaattaccgtt
gatgaaatgactggaggaacctttacaatttccaatggaggtgttttcggaagtatgctt
tcaacaccaattataaacccgccacaatctgcaattttaggaatgcacaatattgtggag
cgcgcaattgtacgtgatggtgggattgttgtcgcgcctgtgatgtatgttgcattgtct
tatgaccacagaattattgatggtcgggagtctgttggattcttggttgcaatcaaggaa
gcgcttgaaagtccagaagaattattgatgaataacaatgttaaacgcgcattagagctg
taa

DBGET integrated database retrieval system