KEGG   Aequorivita sublithincola: Aeqsu_1519Help
Entry
Aeqsu_1519        CDS       T02132                                 

Definition
cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
asl  Aequorivita sublithincola
Brite
Enzymes [BR:asl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Aeqsu_1519
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1628704..1629810)
Genome map
AA seq 368 aa AA seqDB search
MMKQRFGKTYLFLIGFLVLSVLVACSSNDTDPEEPMEQYVPTPKPLIVPSILQRLLPPPY
IPADNTQTVEGIALGRKLFYDPILSGNGTQACASCHQPENSFTDNTRLSIGIDGLEGTRN
SMPLYNMAWNINEEFFWDGRAKSIEIQALEPVINPVEMHNTWQNAVASLQSNVAYPELFN
KAFGTKNITKELTAKAIAQFERTLISANSPFDRYLEGENSLTPQEINGFAIFMDEARGDC
FHCHGNEFSPLWTDNTFHNNGLDAVITDKGLGGVSGDPNEDGKFKSPSLRNLAYTAPYMH
DGRFATLDEVINHYSEGLVYSPTIDPLMKTISKGGVQLTEPDKADLKAFLLSLSDPSFIN
NPDFQDPN
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagcaacgttttggcaaaacatatctatttttgataggctttttggtcctaagc
gttttggttgcttgttcttcaaacgacacagatcctgaagaaccaatggagcaatatgtg
ccaacgcccaaacctttaattgttccttcaattttacaacgcctattgccgccaccatac
attccagccgataatactcaaactgtggaaggaattgctttgggaagaaaacttttttac
gatccaatcctttctggaaatggaacacaagcctgcgcatcttgccaccaacccgagaat
tcatttactgacaatacgcgattgagcatcggtattgatggtcttgaaggaacccgaaat
agcatgccactatataatatggcttggaatatcaatgaagaattcttttgggacggacgc
gccaaaagtatagaaatacaagcactagaaccagttataaacccagtagaaatgcacaac
acttggcaaaacgcagttgccagtttgcaaagtaacgttgcttatcctgaacttttcaac
aaagcttttggaacaaaaaatatcaccaaggaattaaccgccaaagcaatagctcaattt
gagcgtacccttatttctgccaattctccttttgatagatatttggaaggcgaaaattca
ttgacgccacaagaaattaacggttttgcaatttttatggacgaagctcgaggcgattgc
ttccactgtcatggcaatgaattcagtccactgtggaccgataatacgtttcacaacaac
gggctggacgctgttattacggacaaaggattaggcggagtttctggcgatcctaatgag
gatggtaaattcaaatcaccttctttacgaaatctagcttatactgctccttatatgcat
gacggtcgttttgctactcttgatgaagtaataaaccattatagcgaaggcttggtctat
tctccaaccattgatccattaatgaaaactatttcaaaaggtggcgtacaattaacggaa
ccagacaaagcagacctaaaagcttttctactttcactctcggatccatctttcataaac
aatccagattttcaagatcccaattaa

DBGET integrated database retrieval system