KEGG   Aequorivita sublithincola: Aeqsu_1724Help
Entry
Aeqsu_1724        CDS       T02132                                 

Definition
pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase, long form
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
asl  Aequorivita sublithincola
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aeqsu_1724
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aeqsu_1724
   00020 Citrate cycle (TCA cycle)
    Aeqsu_1724
   00620 Pyruvate metabolism
    Aeqsu_1724
Enzymes [BR:asl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Aeqsu_1724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1852030..1853805
Genome map
AA seq 591 aa AA seqDB search
MAEVINMPRLSDTMEEGTVATWLKKVGDTVKEGDILAEIETDKATMEFESFHEGTLLHIG
LNEGETAPVDTLLAIIGKKDEDISDLIGGKSSDKKEISKEDESKDEKKSSDKKKDKSEDE
EEDDDSSEKDANEKEESDDEDSDEDGKSESSSDSAELPEGVEIITMPRLSDTMTEGTVAS
WLKKEGDKVEEGDILAEIETDKATMEFESFYSGTLLKIAIDEGDSSPVDAVLAIIGPKGT
DFSGLLENYKKGGKSSSKKETSSEEKSSKEDKKEDKKEEKKSSDNASEKEGTKKETTLDK
KSESSQTTNEGRIFASPLAKVLAEEKGINLRQVNGSGENGRIIKSDIENYQPAAGGGEAY
TPVGTESFEEVKNSQMRKTIAKRLAESKFSAPEYYLTVELDMDYAIAAREAINADPDVKI
SFNDMVIKACAMALRKHPQVNSQWTPEATRIAKHIHIGVAVAVDEGLLVPVLKFADQMTF
SQIGRHVKELAGKARNKKITPAEMEGSTFTVSNLGMFGITEFTSIINQPNSAILSVGAIV
QKPVVKNGQIAVGNTMIVTLACDHRTVDGATGAKFLQTLRQYIENPVTMFV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtaataaacatgccgcgtttgagcgacacgatggaagaaggaacggtagca
acctggcttaaaaaagtaggcgataccgtaaaagaaggcgatattcttgccgaaattgaa
accgataaagccacgatggagtttgagtcttttcacgaaggaacattgcttcacattggt
ctcaatgaaggtgaaaccgcgccagtggatactcttttggctattattggaaaaaaagac
gaagatatttcagatttaattggcggaaaatcttcggataagaaagaaatatcgaaggaa
gatgaatccaaagatgaaaaaaaatcatctgataaaaagaaggataaatctgaagatgag
gaagaagatgatgattcttcagaaaaagatgctaatgaaaaagaggaatctgacgacgaa
gattcagacgaagatggaaaatctgaaagttcttcagattctgctgaattaccagagggc
gttgaaataattacaatgccacgactaagcgatacaatgaccgaaggaactgttgcatct
tggctcaaaaaagaaggtgataaagtagaagaaggcgatattcttgccgaaattgaaacc
gataaagccacgatggaatttgaatcattctattcaggcacattactcaaaatagctata
gatgaaggcgattcttctcctgttgatgcagttcttgctataattggcccaaaaggaact
gatttttctggtctattggaaaattataaaaaaggaggaaagtcttcaagcaaaaaggaa
acttcttcagaagaaaagtcttccaaagaagataaaaaagaagataaaaaagaagaaaag
aaaagttctgataatgcttcagaaaaagaaggaactaagaaggaaactactttagataaa
aaatctgagtcttcacaaactacaaacgaaggccgaattttcgcttcgcctttagctaaa
gttttggctgaagaaaaaggaataaatctacgtcaagttaacggaagcggcgaaaatgga
cgtatcataaaaagtgatattgagaactaccagccagctgctggtggcggagaagcttac
actccagtaggaaccgaaagttttgaggaagtgaaaaactcccaaatgcgtaaaacaatt
gcaaaacgtttggctgaatctaaattctctgcaccagaatattatttaactgttgagttg
gatatggattacgcaattgccgctcgtgaagcgattaatgcagatccagatgtaaaaata
tcttttaacgatatggttataaaagcctgtgcgatggctttaagaaaacatccgcaagta
aatagtcagtggactccagaagcaaccagaatcgcaaagcatatccacattggtgtggca
gttgcggttgatgagggattattggttcctgttctaaaatttgcagaccaaatgaccttt
tctcaaattggcagacatgtaaaagaacttgctggaaaagcgcgaaataaaaaaattaca
ccagccgaaatggaaggcagtacgtttacagtttcaaatcttggaatgtttggaatcact
gaattcacatctattataaaccaaccaaattccgcaattttatctgttggcgcaattgtt
caaaaaccagttgttaaaaatggtcaaattgcagttggtaatacaatgatagtaactttg
gcctgcgatcacagaactgtggatggcgcaacgggtgcgaaatttttacaaacattacga
cagtatattgagaatcctgtaacgatgtttgtttaa

DBGET integrated database retrieval system