KEGG   Aequorivita sublithincola: Aeqsu_1733Help
Entry
Aeqsu_1733        CDS       T02132                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
asl  Aequorivita sublithincola
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Aeqsu_1733
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Aeqsu_1733
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Aeqsu_1733
Enzymes [BR:asl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Aeqsu_1733
Exosome [BR:asl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Aeqsu_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1863402..1864508)
Genome map
AA seq 368 aa AA seqDB search
MKTKLSLLTLLLSFILIATSCVTVQVKDNTVTQTSLEIKKPKNIILLIGDGMGLSQVSTA
IYYKDGKPNFERFHTIGLSKTSSSNELVTDSAAGATVFSTGEKTYNGAIAVSKDTIPLPT
IVEHLSKRGLATGIVATSSIQHATPASFYAHVKSRRMYEEITEFAPNSGVNFFAGGGLKF
FNQRKDGKDLLEEMKTKGYEVITDKLPTTPSEKNELILLAENGMPKMSEGRGDFLPNATK
LALEKLSKNEKGFFLMVEGSQIDWGGHDNDADYLIQELLDFDKTLGVALDFAKQNGETLV
IVTADHETGGYTLASDGSDYNKIKPSFSTTGHSGTMVPVFAEGPGAILFNGIYESNEIYH
KIMELLKR
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaagctttccctcctcacccttcttttatcatttattttaattgcaacttcc
tgcgttactgttcaagtaaaggacaatacggttactcaaacttctttagaaataaaaaaa
ccaaaaaatattattcttttaatcggtgatggaatgggtttgagccaagtttccaccgct
atttattacaaagacggtaaaccaaattttgaacgtttccataccataggcttgagcaaa
acctcttcttccaatgaattggtaacagattctgctgcaggcgccaccgttttttctaca
ggagaaaagacttataatggagcaattgcggtaagtaaggatactatcccgctcccaact
attgttgaacatttatcaaaaagaggtttggcgacgggaattgttgcaacatcttcaatt
cagcacgccactcctgctagtttttatgcccatgtaaaaagcagaagaatgtatgaagag
attaccgagtttgcgccaaattctggcgtaaacttttttgcgggtggcggacttaaattc
ttcaaccaaagaaaggacgggaaagatttattagaagaaatgaaaaccaaaggctatgag
gtaattacagacaaacttccaactactccgagcgaaaaaaacgaattaattttactcgca
gaaaacggaatgcctaaaatgagcgaaggtcgtggtgacttcctgccaaacgcaacaaaa
ctggctttggaaaaactttcaaaaaacgaaaaaggatttttcttaatggttgaaggtagc
caaatagattggggcggccatgacaatgatgcagactacttaattcaagaactattagac
tttgacaaaactttaggcgtagccttagatttcgcaaaacaaaacggcgaaacacttgtg
attgttaccgcagaccatgaaactggcggttataccttagcttcagacggcagcgattac
aacaaaataaaaccaagtttttccacaaccggacattctggaacaatggttccagtattt
gcagaaggtcctggcgctatactcttcaacggaatttacgaaagcaacgagatttatcat
aaaatcatggagcttttgaaaaggtga

DBGET integrated database retrieval system