KEGG   Aequorivita sublithincola: Aeqsu_1833Help
Entry
Aeqsu_1833        CDS       T02132                                 

Definition
PAS domain-containing protein
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
asl  Aequorivita sublithincola
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:asl00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Aeqsu_1833
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Aeqsu_1833
Enzymes [BR:asl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Aeqsu_1833
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Aeqsu_1833
Two-component system [BR:asl02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Aeqsu_1833
Bacterial motility proteins [BR:asl02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Aeqsu_1833
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1973629..1978083)
Genome map
AA seq 1484 aa AA seqDB search
MGKPIEKLIKSANKFPVVGIGASAGGLAAFKKLVEAIPEDSGMAYVIVQHLDPNHESLLA
ELLQKVTKIPVLEIADDIKVEPDHIYIIPSNKMLLANDGVLELSPRPTPNKSVRNLPIDL
FFRSLAEVHQNHSLGVVLSGTGSDGTAGLMAIKDNGGITFAQDQQSAEWDGMPQSAVDAG
VVDFILKPEEIPAKILDLIRSMDRNGFEKEDISHQEEEVFRKILSLLRIRKGTDFTYYKQ
TTIRRRILRRMAINKNKKPANYLAYLRENKNEQDVLYQDLLIPVTSFFRDVDIFDTLCER
LIPMLQNKEGNESLRLWSAGCSTGQEAYSLLICLKEYLNANPTLNGDKSAKAGIKIQLFA
TDISEPAIAKARKGLYTTSEVENVSPKRLKEFFTKTKTGYQLNKEIREMCVFALHNFLSD
PPFGNMDIISCRNVLIYFQPYLQKKALATFHYSLNENGYLLLGKSETNSSMSEQFSPVNK
KDKLFMRKNSATSVIKSSTRYSEKRLHTNEESEPETEKKRTDFKKIADELLLSRFTPASV
VVNEAMDIILFNGNTNSYLGQQSGKPSHNLFKMAKGSLAIELRNIIHKVKTEGTSVTKEN
VPFVENDIRQLICLEAVPLPNVVEPHYLVLFHRQLAAQEDLTLNKKDSEKDEKDLRIRQL
ENELEQTLEDMRSITEDQEAANEELQSANEELLSGGEELQSLNEELETSKEELQSTNEEI
TVINHELINLNELVTEERNYAESIVETIHEPLLVLDKNLKVSAANNSYYKTFHTKEKETE
GKLIYELGNNQWNIPELRRQLETILPKKNSFEDFEVVHTFEHIGERSMCLNATEIKREDR
SKNLILLAIKDITVQKLHWKRKQELLEKFKNLVMQAPVAIMFLKGKNYKVELANDLFLQL
VEKGKNFVGKPIFEALPELKEHGLKKLLYNSLKSGEPYYGNEMEVKMGREKKAEPGFYNF
VCQPMRDQDNIITGIMVIVNEVTEQVLARKMVEESAHRYNEMIHSSPSLIAIFVGEDLVI
STANDAILEAWGKDKSAIGKPLMDAIPELEGQGFDKHLLDVLKTGKAYHAHEMPMNLIRN
GKMEMPYFDFVYQAQRDLDGKIEGVAVISTEVTIQAELHKKLKLSEARFHQMTDLVPDMI
INATVDGELFYFNNVWTDFSGLTMKKIKKEGWGRLMHPEELPTVEHNWMNAVKTGNDFEM
EFRLLDRNGDFKWHISRANPVKDETGKIIMWVGASTEIQKLKDEEKRKEDFLKMVSHELK
TPITSIKGYTQLLLSMLKSVAQDNIGTVPLIPSLERIDSQVSRLTRLISEMLDLSRMEES
KLELQQKTFSINEFVENCVNDIKYTNDEYKIKITHDDTFSVNGDKDRINQVLINFITNAI
KYSPIDKNILVRIYKVDEENGAVSIKDKGIGIDKKDHEHLFKKFYRVSGKDETNFSGFGI
GLFLAKEIIERHNGYVDVKSKKGKGSEFIFTLPIIAENNHKNKE
NT seq 4455 nt NT seq  +upstreamnt  +downstreamnt
ttgggcaaaccaatagaaaaactcataaaatctgccaacaaatttccagtagtgggcata
ggcgcctcagccggtggcttggccgcatttaaaaaattagtggaagcaatccctgaagat
tcgggcatggcctacgtgatcgtgcaacatttggatcccaaccacgaaagtctgttggca
gagctgttgcaaaaggttacaaaaatcccggtgctggaaatcgcagacgatattaaagta
gaacccgatcacatatacattatccccagcaacaaaatgctgctggccaatgatggggtt
ctggaacttagcccgcggcctacccccaataagagcgtgcgaaacctgcccattgatctc
tttttcagatcgctggcagaagtgcaccaaaatcattcattgggcgttgtgctttccggc
acagggtctgacggtaccgcggggttaatggccattaaagataatggcgggattaccttt
gcacaagaccaacaatctgccgagtgggacgggatgccccagagcgctgtagatgctggc
gtggttgattttatactcaagcccgaggaaataccagccaaaattttggatttgataaga
tctatggatagaaatggctttgagaaagaagacatttcgcatcaggaagaagaggttttc
cggaaaatcctttcattgttgcgcatacgcaaaggtaccgactttacctattacaaacag
accaccatccgccgaaggatactgcgcaggatggccatcaataaaaacaaaaagccagca
aactatcttgcttatttaagggaaaacaagaacgagcaggatgtattgtaccaagattta
ctgattcccgtaacatcatttttcagggatgtggatatttttgataccctatgtgaacgc
ttgataccaatgctacagaacaaagaaggcaatgaatccttacgcctttggtccgcagga
tgcagtactggccaagaagcttactcccttcttatttgcttgaaggaatacttaaatgcg
aacccgacattaaatggcgacaaatcagctaaggcaggtattaaaatacagttatttgcc
acagacatcagcgaacccgccatagcaaaggcaagaaaagggctctacacaaccagtgaa
gtggaaaatgtaagccctaagcggctgaaggaattctttaccaaaaccaaaacaggctac
cagcttaacaaagaaatcagggaaatgtgcgtatttgcgttacataatttcctgagcgat
cccccttttggcaatatggacattataagctgcagaaacgtactcatctattttcagcca
tacttgcagaaaaaagcgcttgccacgtttcattactccttaaatgaaaatggatatctg
ttgctcggaaaatcggaaactaacagcagtatgtctgaacaatttagcccagtaaacaag
aaagacaagctatttatgcggaaaaactcggcgacttccgttataaagtcctccacgaga
tatagcgaaaaaaggttgcataccaatgaagaatctgagccagaaaccgaaaaaaagcgc
accgattttaaaaaaatagcggacgaactattgttaagccgttttacccccgccagtgtt
gtggtgaatgaggccatggacattatcctttttaatggtaataccaacagctatttaggg
cagcaaagtggcaagcccagccataacctgttcaaaatggctaaagggagtttggcgatt
gaactgcgaaacatcatccataaagtaaagacagagggcacttcggttacaaaggaaaat
gtcccttttgttgaaaatgacatccggcagctaatctgtttggaagccgtgccgcttcca
aatgtggttgaaccgcattatttggtactatttcaccggcagttagcagcccaggaagat
cttaccctaaataaaaaagattccgaaaaagatgaaaaggacctgcgcatcaggcaattg
gaaaatgagcttgagcagacccttgaagatatgcgcagcatcaccgaggatcaagaggcc
gccaatgaagaattgcaaagtgcaaatgaagaactgctgagcggaggcgaggaactgcaa
agcctgaacgaggaactggaaaccagtaaggaggaactgcaaagcactaatgaagaaata
acagtaataaaccacgagctcatcaacttaaacgagctggtaaccgaagagcgcaattat
gccgaaagcattgtggaaaccatccatgaacccttgttggttttagacaagaacctcaaa
gtaagcgccgctaacaattcttattataaaaccttccatactaaagagaaggaaacagaa
ggcaagttgatctatgaactgggcaacaaccaatggaacatccctgaattacggaggcag
cttgaaaccattctgcccaaaaaaaatagctttgaagattttgaggtagtccatactttt
gaacacattggggaacgcagcatgtgtttaaatgccacggagattaaacgcgaggaccga
tctaagaatttgatcctcttggcaattaaggatattacggtacaaaagcttcattggaaa
agaaaacaagaacttttagagaaatttaaaaacttggtaatgcaggcccccgtggccatc
atgtttttaaaaggtaaaaattataaagtagaactggccaacgatcttttcttgcagttg
gttgaaaaagggaaaaactttgtgggtaagcccatttttgaagccttgcccgaacttaaa
gaacacggtctcaaaaaacttctttacaactcactaaaaagcggggaaccttactacggt
aacgaaatggaagtgaagatgggcagggaaaagaaagccgaaccgggattttataatttt
gtgtgccaacccatgcgcgatcaagacaatattattaccgggatcatggtaatagtaaat
gaagtaaccgagcaagtacttgcccgaaaaatggtagaggaaagtgcgcacaggtataat
gaaatgatacattcttcgccttcccttatcgctatttttgtaggagaagatttagtgata
tccacggccaacgatgccattttggaagcgtggggcaaagataaaagtgccatcggcaag
cccttaatggatgctataccggaactggaagggcagggttttgataagcatttgctggac
gttctaaaaactggcaaagcctatcatgcccacgaaatgcccatgaaccttattcgcaac
ggtaagatggaaatgccttatttcgattttgtttaccaagcccaacgggatttggatgga
aaaattgagggtgttgccgttatctcgaccgaagttactatccaagccgaactgcataaa
aaactaaaactaagcgaagctcggttccatcaaatgaccgacttggtgccagatatgata
atcaatgcaaccgtggatggggaactattttatttcaacaacgtctggaccgatttttct
ggattgaccatgaaaaaaataaaaaaagagggttgggggagattgatgcacccagaggag
ttacccacagtcgaacacaactggatgaatgcagtgaaaaccgggaatgattttgagatg
gaatttagacttcttgacagaaatggggattttaaatggcatattagccgcgccaatccc
gttaaagatgaaaccggaaaaatcattatgtgggtaggtgccagtaccgaaatacagaaa
ttaaaggatgaggaaaaacgtaaggaagatttccttaaaatggtaagccacgagctcaag
acacccattacctcaattaaaggatatacccaattgttgttgagcatgctgaaaagtgtg
gcgcaggataacataggcaccgttccattgatcccgagcttggagcggatagacagccaa
gtatctcggcttacccgtctcatttcagaaatgctggatctttcacgtatggaggagagc
aaactggaattgcaacagaaaactttcagcataaacgaattcgtggaaaactgtgttaat
gacatcaaatataccaacgacgaatacaaaattaagataacccatgatgatacattcagt
gtgaatggcgacaaggacaggattaatcaagtcttgatcaacttcattaccaatgccatc
aaatattctccaattgataaaaacattctcgttcgtatttacaaagtagatgaagaaaat
ggtgcggtaagcataaaggataaaggaatcgggatcgacaaaaaggaccatgagcaccta
tttaaaaagttctatcgtgtcagcggaaaagacgaaacaaatttttccggttttggaatc
ggcctctttttggccaaagaaattatagagcgtcacaatggatacgttgacgtaaagagc
aaaaaaggaaaaggatccgaatttatttttacccttcccattattgccgaaaataatcat
aaaaataaggaatga

DBGET integrated database retrieval system