KEGG   Aequorivita sublithincola: Aeqsu_1958Help
Entry
Aeqsu_1958        CDS       T02132                                 

Definition
(GenBank) outer membrane phospholipase A
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
asl  Aequorivita sublithincola
Pathway
asl00564  Glycerophospholipid metabolism
asl00565  Ether lipid metabolism
asl00590  Arachidonic acid metabolism
asl00591  Linoleic acid metabolism
asl00592  alpha-Linolenic acid metabolism
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Aeqsu_1958
   00565 Ether lipid metabolism
    Aeqsu_1958
   00590 Arachidonic acid metabolism
    Aeqsu_1958
   00591 Linoleic acid metabolism
    Aeqsu_1958
   00592 alpha-Linolenic acid metabolism
    Aeqsu_1958
Enzymes [BR:asl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Aeqsu_1958
    3.1.1.32  phospholipase A1
     Aeqsu_1958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1
Motif
Other DBs
NCBI-ProteinID: AFL81431
UniProt: I3YWR3
Position
complement(2102264..2103157)
Genome map
AA seq 297 aa AA seqDB search
MKYPQFLFFACFIMLCSHVVAQSVTKYPTLAEAWQLDSTSRSKQVEFRLLPYKPVYILFA
NYTTNVNHSPASSNENNVVEEPIPYNNVELAFQISFKTKILHNILGEKLGGDVWGAYTQS
SRWQIYNNTLSRPFRETNYQPEAFLLFGTPYNIGNFKGVFTGFGLNHQSNGRSNPLSRSW
NRIIFQAGWEVNNVQIVLKPWIRLPEAEKNDDNPDINDFMGRAELDLSYAFGKHDFQLVT
RHSLRDGDKSHGSARLDYSYRFIKNLKIHAQVFTGYGESLIDYNHNQTTVGVGISLY
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatccccaatttctattcttcgcatgctttataatgctttgttcacatgtggtt
gcccaaagcgtgacgaaatacccaacactggcggaagcttggcagttggattccacttca
cgttctaaacaggttgaatttagacttttaccttataagcctgtctatatattgtttgcg
aattatactaccaatgttaatcattctccagcaagcagcaatgaaaacaatgttgttgag
gaacccattccatacaacaatgtggagttagcatttcaaataagttttaaaacaaaaatc
cttcataatatcctaggtgaaaagttgggtggcgatgtttggggagcctatactcaaagt
tcgcgttggcaaatttataacaacacactttccagaccttttcgggaaactaattaccaa
cctgaagcctttttactttttggcactccttataatattggaaattttaaaggtgttttt
acaggtttcggattaaaccatcaaagcaatggtcgttcaaacccactgagtagaagttgg
aaccgtattatttttcaagctggttgggaagtgaataatgtgcaaattgttctgaaaccg
tggatacggctaccagaagcggaaaagaatgacgacaatccagacattaatgattttatg
ggccgggcagaattagatcttagctatgccttcggaaaacacgattttcaattagttacg
cggcactctcttcgtgatggagataaaagtcacggaagcgcaagactggattacagttac
cgtttcataaaaaacttaaaaatccacgcgcaagtttttacaggatatggagaaagctta
attgattataaccacaaccaaactactgttggcgtaggtatttcgttgtattaa

DBGET integrated database retrieval system