KEGG   Aequorivita sublithincola: Aeqsu_2084Help
Entry
Aeqsu_2084        CDS       T02132                                 

Definition
DNA replication and repair protein RecR
Orthology
K06187  
recombination protein RecR
Organism
asl  Aequorivita sublithincola
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Aeqsu_2084
DNA repair and recombination proteins [BR:asl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Aeqsu_2084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2255697..2256317
Genome map
AA seq 206 aa AA seqDB search
MEFSSKLLENAVNEMSQLPGIGKRTALRLVLHMLKQPKEQTQKLASSLTKMREEINFCAN
CHNISDTKLCEICANPRRDEQLVCVVEDIRDVMAIENTSQYRGHYHVLGGKISPMDGIGP
GDLTIPSLVEKVKTGNIRELIFALSSTMEGDTTNFYIYKQIESYSIITTTIARGISVGDE
LEYADEVTLGRSILHRIPFESSLKSL
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggaattttcttcaaaacttcttgaaaacgcagtaaacgaaatgtctcaacttcctgga
atcgggaagcgtacagctttgcgtttagtgcttcatatgttgaaacagccaaaggagcaa
acacaaaaattggcatccagtttgaccaaaatgcgcgaggaaataaacttctgcgcaaac
tgccataatattagtgatacaaagctttgcgaaatatgcgccaacccacgccgtgacgaa
cagttggtttgtgtagttgaagatattcgcgatgttatggcaatagaaaatacaagtcaa
tatcgcggtcattatcacgttttgggtggcaaaatttcgccaatggacggaattggtccg
ggtgatttaaccattccttctttagttgaaaaagtaaaaacaggaaacattcgtgaactt
atttttgcgctcagctcaactatggaaggtgataccaccaatttctacatctacaaacaa
atagaatcttacagcataattacaaccacaattgctcgtggaatttcagtaggtgacgaa
cttgagtatgccgatgaggttacgctaggacgaagtattttgcatcgaattccttttgaa
tcttcactaaaaagcctgtag

DBGET integrated database retrieval system