KEGG   Aequorivita sublithincola: Aeqsu_2086Help
Entry
Aeqsu_2086        CDS       T02132                                 

Definition
(RefSeq) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase component
  KO
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
asl  Aequorivita sublithincola
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Aeqsu_2086
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Aeqsu_2086
  Amino acid metabolism
   00310 Lysine degradation
    Aeqsu_2086
Enzymes [BR:asl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Aeqsu_2086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2257581..2258897
Genome map
AA seq 438 aa AA seqDB search
MAKFELKLPKMGESVAEATLTNWLKEVGDTIEADEAVLEIATDKVDSEVPSEVDGVLIEK
LFNVDDVIQVGQTIAIIEIAGGSDESPKASTESTPAPEVIKEVEKHVETAKQATHAPIEN
KGDRFYSPLVKNIAAAEGISQTELDGISGSGKDGRVTKNDILGYVENRSTAKPQPQAVAE
TKTPETAKPSEPTKPKAAVSVGGDDEIIEMTRMGKLIAHHMVESTQSAAHVQSFIECDVT
NIWNWRNKMKTAFAKREGENLTFTPIFMEAVAKALKDFPMMNIAVDGNNIIKRKNINLGM
AAALPDGNLIVPVIKNADRLNLLGMSKAVNDLATRARENKLKPDDIQGGTYTVTNVGTFG
SIMGTPIINQPQVGILALGAIRKVPAVIETPEGDFIGIRFKMFLSHSYDHRVVNGALGGQ
FVKRVADYLEDWDVNREI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatttgaattgaaacttcccaaaatgggcgaaagtgttgcagaagcaacctta
actaattggctaaaagaagtgggcgacactattgaagccgatgaagctgtgcttgaaatt
gcgaccgacaaggtggacagtgaagttcccagcgaggtagatggcgttttgattgaaaaa
cttttcaatgtagatgatgtaattcaagtaggtcaaaccattgccattattgaaatcgct
ggtggaagcgatgaaagcccaaaagcaagcactgaaagcactcccgcgccagaagttatc
aaggaagttgaaaaacacgttgaaactgccaaacaagcaactcacgcaccaattgaaaat
aaaggcgatcgtttctattcgccattagtaaaaaatattgctgctgcagaaggtatttcc
caaacagaactagacggaatatcaggaagcggaaaagatggacgtgttaccaaaaatgat
attttgggttatgtagaaaatcgttcaactgcaaaaccgcaaccgcaagctgttgctgaa
actaaaactccagaaacagcaaaaccttcagaacctacaaaaccaaaagctgcagtatca
gttggcggcgatgatgaaattattgaaatgactagaatgggcaaattaatcgcccatcat
atggttgaaagcacgcaaagcgctgcgcacgtgcaatcgtttatagaatgcgatgttacc
aatatttggaattggagaaataaaatgaaaactgccttcgctaaacgtgaaggagaaaat
ttaaccttcaccccaatatttatggaagccgtggctaaagccttaaaagacttcccaatg
atgaatattgctgtagatggtaataatatcatcaaacgtaaaaacataaacttaggtatg
gccgcggcacttccagacggaaacctaatcgttcccgtaatcaaaaacgcagaccgattg
aatttgcttggaatgagcaaagcagtaaacgatcttgcaacccgagcgcgcgaaaacaaa
ttgaagccagacgatattcaaggcggtacttatacggttacgaacgttggaacctttggt
agtattatgggaactccaatcattaatcaaccacaagtaggtattcttgccttaggagca
ataaggaaggtgcctgcagttattgaaaccccagaaggagattttattggtattcgtttc
aaaatgttcctttctcacagttatgatcacagagttgtaaacggtgcgttgggaggacaa
ttcgtgaagcgtgttgctgattatttggaagattgggatgtaaatagagaaatctaa

DBGET integrated database retrieval system