KEGG   Aequorivita sublithincola: Aeqsu_2541Help
Entry
Aeqsu_2541        CDS       T02132                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asl  Aequorivita sublithincola
Pathway
asl00010  Glycolysis / Gluconeogenesis
asl00030  Pentose phosphate pathway
asl00051  Fructose and mannose metabolism
asl00052  Galactose metabolism
asl00680  Methane metabolism
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
asl01120  Microbial metabolism in diverse environments
asl01130  Biosynthesis of antibiotics
asl01200  Carbon metabolism
asl01230  Biosynthesis of amino acids
asl03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aeqsu_2541
   00030 Pentose phosphate pathway
    Aeqsu_2541
   00051 Fructose and mannose metabolism
    Aeqsu_2541
   00052 Galactose metabolism
    Aeqsu_2541
  Energy metabolism
   00680 Methane metabolism
    Aeqsu_2541
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Aeqsu_2541
Enzymes [BR:asl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Aeqsu_2541
Protein phosphatases and associated proteins [BR:asl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Aeqsu_2541
Messenger RNA biogenesis [BR:asl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Aeqsu_2541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat DDE_Tnp_2
Motif
Other DBs
NCBI-ProteinID: AFL81997
UniProt: I3YYC9
Position
2735589..2736572
Genome map
AA seq 327 aa AA seqDB search
MKTPKKIAVLTSGGDAPGMNAAIRAVVRSCAYHNLECVGVYRGFQGLIEGDFKELNARTV
KNIINRGGTFLKSARSKDFLTLEGRKKAFENLQNENINALVVIGGDGTFAGASAFAEEFN
FPIVGIPGTIDNDINGTDYTIGYDTALNTVVEAIDKIRDTANSHNRLFLVEVMGRDAGDI
ALNAGIGAGAEEILIPEQNMGKERLLESLSRSKKSGKTSSIVVVSEGDQIGKNIFELAKY
IEENLKEYEVRVTVLGHIQRGGAPSCYDRVLASRLGVGAIDALLGGETNVMIGIVHNKVT
SVPFSEAIKGNNEIDEELIRVADIISI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaccaaaaaaaatagcggttttaaccagcggaggggatgcacccggtatgaat
gctgcgatacgggcggttgttcgttcttgcgcatatcacaatcttgagtgcgttggcgtc
tatcgtggcttccaaggtttgattgaaggcgattttaaggaacttaacgcacgtacggta
aaaaatataattaatcgcggaggcacatttcttaaatctgcgcgttccaaagattttttg
actcttgaaggaagaaaaaaggcttttgaaaaccttcaaaatgaaaacataaatgccttg
gtcgtcataggcggcgacggtacttttgcgggagcttctgcttttgctgaagaattcaac
tttcctattgtgggaattcctggaactatagataatgacattaatggaactgattatacc
ataggttacgacacagcattaaatactgtggttgaggcaattgataaaatccgtgacacg
gcaaattctcacaaccgtctttttttagtggaagtgatgggtcgtgatgctggcgatata
gcgttaaatgctggaattggcgcaggagcggaggaaattctgattccagaacaaaacatg
gggaaagagcgtttgttggaatctttaagtcgaagtaaaaaatctggtaaaacttcaagt
attgttgttgtttcagaaggggaccaaataggaaagaacatttttgaactcgcaaaatat
attgaagaaaacctaaaagaatacgaagttagagttaccgttctaggccacattcaacgc
ggtggcgcgccaagttgttatgatcgcgtgcttgcaagccgtttaggggttggtgccatt
gatgcgctcttaggtggcgaaacaaatgttatgataggcattgttcacaataaggtaacc
tcggttcctttttccgaagcaataaaaggtaacaatgaaattgatgaagaattgattcgt
gtggcagatattatttcgatttga

DBGET integrated database retrieval system