KEGG   Aequorivita sublithincola: Aeqsu_2688Help
Entry
Aeqsu_2688        CDS       T02132                                 

Definition
lysophospholipase L1-like esterase
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
asl  Aequorivita sublithincola
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Aeqsu_2688
Enzymes [BR:asl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Aeqsu_2688
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Aeqsu_2688
Lipid biosynthesis proteins [BR:asl01004]
 Fatty acid synthase
  Component type
   Aeqsu_2688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2892168..2892920)
Genome map
AA seq 250 aa AA seqDB search
MPNPKITQSLLNPTVSTYRNLLKFCYFLTVFVLISCGNDTKSKATLNATENATTETESSE
KASSKTILFFGDSITAGYGLDDTNDAFPGIIQTKIDSLGLNYQVVNSGVSGETSAGGKSR
IDWILNQDIDIFILELGANDGLRGVAITETKANLQAIIDAVKAKSPNTKIVLAGMQLPPN
MGADYTTQFKEVFSDLASKNDLAFIPFILKDVGGVKKLNQNDGIHPTAEGHKILAKTVWE
VLSGVIKEEA
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgccgaatcccaaaattacgcaaagccttttaaatccaactgtttcgacgtatcgaaac
ctcttaaagttttgttatttcttgaccgtttttgttttgatttcctgcggaaatgataca
aagtcaaaagctactttaaatgcaactgaaaacgcaactacagaaactgaatcttctgaa
aaggcttctagcaaaaccattctattttttggcgatagtattactgctggctatggctta
gatgatactaacgatgcttttccgggaattattcagactaagatcgattcattggggttg
aattatcaagttgtaaactctggagtgagtggggaaacttccgcaggtggcaaaagtaga
atcgattggattttaaaccaagatatcgacatcttcattttagaactcggcgccaacgac
ggacttcgaggtgttgctatcactgaaaccaaagctaacttacaagcaatcatagatgca
gtaaaagcaaaaagtcccaatacaaaaattgttttggcgggaatgcaattgcccccaaat
atgggagccgactacaccacacaattcaaggaggttttctctgatttggcttctaaaaat
gatttggcatttattccttttattctgaaggatgttggtggagttaagaaattaaaccag
aatgatggaattcaccctactgctgaagggcataaaattttggctaagactgtttgggag
gtgctttcgggagttattaaagaggaagcgtaa

DBGET integrated database retrieval system