KEGG   Aequorivita sublithincola: Aeqsu_2763Help
Entry
Aeqsu_2763        CDS       T02132                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
asl  Aequorivita sublithincola
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:asl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:asl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2971475..2972410)
Genome map
AA seq 311 aa AA seqDB search
MELSVNHLLGIKYITEADIQLIFETADHFKEVINRPIKKVPSLRDITIANLFFENSTRTK
LSFELAEKRLSADVINFASSSSSVTKGETLIDTVNNILSMKVDMVVMRHPNPGAGVFLSK
HVDASIINAGDGAHEHPTQALLDTYSIREKLGDVAGKKVVIVGDILHSRVALSNIFALQK
LGATVKVCGPKTLIPKYIEKLNVQFEPNLVKALEWCDVANMLRVQNERMDISYFPTTREY
TQQFGLNKKLLDSLNKEIVVMHPGPINRGVEITSDVADSKQSIILEQVQNGVAIRMAVIY
LLASKIKHHED
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggaactgagtgtaaaccacttactaggaataaaatatatcaccgaagccgatattcaa
ctcatcttcgaaacggcagatcatttcaaggaagttattaaccggcccattaaaaaagtt
ccttcgcttcgcgatattacgattgccaatcttttctttgaaaacagtaccagaacaaaa
ctttcttttgaacttgctgaaaagcgtctttcagcagacgttattaattttgcatcttca
agttcttcagtaaccaaaggcgaaacgcttattgatactgtaaacaacatattatcaatg
aaggttgatatggtggtgatgcgccacccaaatccaggagctggagtatttctttcaaaa
cacgttgacgcaagtataataaacgctggagacggtgcgcacgaacatccaacccaagca
ttgctcgacacgtattcaattcgtgaaaaacttggagatgtagctggaaaaaaagttgtt
attgttggtgatattcttcattcacgagttgctttatcaaacatttttgcacttcaaaag
ctaggagcgacggttaaggtgtgcggtcctaaaacgcttattccaaaatatatagaaaaa
ttaaatgttcaatttgaaccaaacctcgtaaaagctttagaatggtgtgatgttgcaaat
atgcttcgtgttcaaaacgaacggatggacattagttattttccaacaactagagaatat
acgcagcaattcggcctaaacaaaaagttgctggattcgctaaataaagaaattgtagta
atgcacccaggcccaataaaccgtggtgtggaaattactagtgatgtagcagacagcaaa
caatcgatcattttagaacaagtacaaaacggagttgccatccggatggcagtaatctat
ttattagcttcaaaaataaaacatcatgaagattga

DBGET integrated database retrieval system