KEGG   Aequorivita sublithincola: Aeqsu_2916Help
Entry
Aeqsu_2916        CDS       T02132                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
asl  Aequorivita sublithincola
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Aeqsu_2916
Enzymes [BR:asl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Aeqsu_2916
Peptidases [BR:asl01002]
 Cysteine Peptidases
  Family C44
   Aeqsu_2916
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3153933..3155795)
Genome map
AA seq 620 aa AA seqDB search
MCGFTGFIDFNKKSELVHLEKMTDSLAHRGPDASSTYIYEEPEFTLGLGHRRLSVIDLAV
GANQPMHHKDLSIVYNGEVYNYKEIKQKLEAVGRSFVTSSDTEIILQAFDEWGDTCVKDF
IGMFAFVIFNKKTKQLIAFRDRPGVKPFYYYWHENILLFASEIKAFHEHPQFSKVLDTQS
VAQFLQYGNIPSPNSIFKNVKKMNAGSILKFSTETKELKTYKYWSVDTFYEKERLKLDFE
EAKQQIESLLISACNYRMVADVPVGVFLSGGYDSTLVTSILQKHNSKKIRTFTVGVNDPN
LNEAKFAKETAAYLGTDHTELYCNEEELLDLIDDVPFYYDEPFGDSSAIPTMLVSKMARQ
HVTVALSADGGDEVFGGYERYNYLSKFKIIKAASKIPLSYNALVNLLVKDNYQASRLKDL
FKDTSPERLANVLNVAYAENDIQKYFKSNINTPVFNFENLKNTNITGDLSRMMAYDYKTY
LLDDILPKVDRATMSVSLEGREPLLDHRLIEFAAQLPENYKINNGVKKYILREITHNYVP
KEMMERKKMGFAVPVKKWLLGVLAEKIEYYLGKTFLEKQKIFNANEVSKLVQTIRTENGK
DYEKLWYFLMFQLWYEKWMM
NT seq 1863 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggttttacgggttttatagattttaataaaaaaagcgaattggttcatttggaa
aaaatgactgatagtctcgcccaccgtgggccagatgcatcttccacgtatatatacgaa
gaaccagaatttactttaggactaggccatagaaggctgagcgtgatagacttggctgtc
ggtgccaatcaacccatgcaccataaggacttaagtatagtctataatggtgaagtttat
aattataaggaaataaaacaaaaactagaagctgttggtcgtagttttgtaacatcaagc
gataccgagataattttacaggcttttgatgaatggggagacacttgtgtaaaggatttt
atcgggatgttcgcctttgtaattttcaataaaaaaacaaaacagttaatcgcttttagg
gataggccaggggtaaagccattttattattactggcatgaaaatatactcttgtttgcc
tcagaaataaaagcatttcatgagcatccacaatttagtaaagtattagatactcaaagc
gtcgctcaatttttacaatacgggaatattccatctcctaattctatctttaaaaatgtt
aagaaaatgaacgctggttccattttaaaattttcaacggaaaccaaagaattaaaaacc
tataaatattggagtgttgataccttttatgaaaaggagcgactgaaattggattttgag
gaagcgaaacaacaaattgagtctttacttataagtgcctgcaattatcgtatggtagcc
gatgtgcctgtaggggtgtttttgagtggaggttacgatagtaccttagttacaagtatt
ttgcaaaagcacaactcaaagaaaatacgaacgtttaccgtaggggtgaacgacccaaat
ttaaatgaagcgaagtttgccaaggaaacggctgcatacttaggtaccgatcataccgag
ctatattgtaatgaggaagaacttcttgatttaattgatgatgtacccttttattacgat
gaaccttttggggattctagtgctataccaaccatgttggtaagtaaaatggcgcggcag
catgttaccgttgcgctttcggcggatggaggcgatgaagtttttggaggctatgaacgc
tataattacctatcaaaatttaaaataataaaagctgccagtaaaatacctttatcctac
aacgctttggttaatcttttggttaaagataattaccaagcctcccgcttaaaagactta
tttaaagatacttctccagaaagattggcaaacgttctgaatgttgcttatgctgaaaat
gatattcagaaatattttaaaagtaacataaatacacctgtatttaattttgaaaaccta
aaaaacaccaatattactggagatctttcgcgtatgatggcgtatgactataaaacatat
ctgctagatgatattttgcctaaagtagatagggcaacaatgagtgtaagtttagagggt
agagaacccctgttagatcataggcttatagaatttgcggctcaacttcctgagaattat
aaaattaacaatggcgtaaaaaagtatatattaagagaaattactcacaactacgtacca
aaggagatgatggaacgtaaaaaaatggggtttgcagtaccagttaaaaagtggctttta
ggtgttcttgctgaaaaaatagagtattacttaggaaagacttttttagagaagcaaaag
atttttaatgcaaatgaagtgtcaaagttggtacaaaccatacgcactgaaaatgggaaa
gattatgaaaagctatggtattttttaatgttccagctatggtatgaaaaatggatgatg
taa

DBGET integrated database retrieval system