KEGG   Aequorivita sublithincola: Aeqsu_2940Help
Entry
Aeqsu_2940        CDS       T02132                                 

Definition
3'(2'),5'-bisphosphate nucleotidase (EC:3.1.3.7)
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
asl  Aequorivita sublithincola
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:asl00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3178368..3179156)
Genome map
AA seq 262 aa AA seqDB search
MKTNLSIAIKAALDAGIEILKVYETDFGVETKDDNSPLTQADKNANEVINGYLKPTGIQI
ISEENRQLDYSERKDWTRCWIVDPVDGTKEFIKRNGEFTVNIALIENGSPILGVIYVPVS
KELYFTSEDEKSSKKIIVSSEKISLEEIFEKAKIIKPSPITSEVIVVGSRSHLNEDTKNF
ISEIEKDNRVEIVSKGSSLKFCLVAEGLAHIYPRFAPTMEWDTAAGHAICNAAGVLVIDQ
STGKPMQYNKPNLLNNYFLVKR
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactaatttatcaatagccataaaagctgctttagatgcaggaatagaaatactt
aaagtgtatgaaacagactttggtgtggaaacaaaggatgacaattcccctttaacgcaa
gccgataaaaacgcgaatgaagtgattaacggctatttaaaacctacaggcattcaaatt
ataagtgaagaaaatcgtcagctagattattctgaaagaaaagattggacccgttgctgg
attgtggatccggttgatggcactaaagaatttataaaacgcaatggcgaattcactgta
aatattgcccttatagaaaatggcagtccgattcttggtgtgatatatgttccagtttca
aaagaactatattttacttctgaagacgaaaaatcttcaaaaaagattattgtttcttcg
gaaaagatttccttggaagaaatattcgaaaaagctaaaattataaaaccatcgccaatt
acttccgaagtaatagttgttggtagtcgttcgcatctaaatgaagacactaaaaatttc
atttcagaaatagaaaaggataatagagtagaaatcgtttccaaaggaagttctttaaag
ttctgtttggtggctgagggtttggcgcatatttatccgcgattcgcgccaacaatggag
tgggatactgcggctggccacgctatttgtaatgccgcgggtgttttagtgatagaccaa
agcacaggaaaaccaatgcaatacaacaaacccaatttattgaacaactattttttggtg
aagcgttaa

DBGET integrated database retrieval system