KEGG   Aequorivita sublithincola: Aeqsu_3201Help
Entry
Aeqsu_3201        CDS       T02132                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
asl  Aequorivita sublithincola
Pathway
asl00010  Glycolysis / Gluconeogenesis
asl00620  Pyruvate metabolism
asl00640  Propanoate metabolism
asl00680  Methane metabolism
asl01100  Metabolic pathways
asl01110  Biosynthesis of secondary metabolites
asl01120  Microbial metabolism in diverse environments
asl01130  Biosynthesis of antibiotics
asl01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:asl00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Aeqsu_3201
   00620 Pyruvate metabolism
    Aeqsu_3201
   00640 Propanoate metabolism
    Aeqsu_3201
  Energy metabolism
   00680 Methane metabolism
    Aeqsu_3201
Enzymes [BR:asl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Aeqsu_3201
Lipid biosynthesis proteins [BR:asl01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Aeqsu_3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AFL82630
UniProt: I3Z062
Position
3471835..3473742
Genome map
AA seq 635 aa AA seqDB search
MSNYHIKNLEEYFQVYRKSVRDPENFWEEIAEENFMWRKRWDKVLEYDLSKPEVSWYKGA
KLNITENCIDRHLYARGNKTAIIFEPNNPSEEAEHITYNQLHDRVCRFANVLLDHGVKKG
DRVCIYLPMIPELAVSLLACARIGAIHSVVFAGFSSTALHTRINDSDCKMVITSDGSYRG
GKTIDLKGIVDEAMNSCPNVKTVLVAKRMNSEITMKEGRDKWLQPLLDEASNQCAPEIMD
AEDPLFILYTSGSTGKPKGMVHTTAGYMVFTAYTFKNVFQYRENDVYWCTADIGWVTGHS
YIVYGPLANGATTVLFEGVPSYPDFGRFWQVIEKHKINQFYTAPTAIRALAKERLDFSAN
YDLSSLKILGSVGEPINEEAWHWYNDNIGKKNCPIVDTWWQTETGGIMISPIPYSTPTIP
TYATLPLPGIQPALMDENGDELKGNLVSGRLCIKFPWPGMARTIWNNHERYRETYFSTFK
NNYFSGDGALRDSTGYYRITGRVDDVIIVSGHNLGTAPIEDAINEHPAVAESAIVGFPHD
VKGNALYGFVILKETGETRLHENLRKEINQIITEHIGPIAKLDKIQFTTGLPKTRSGKIM
RRILRKIAEKDTNNLGDISTLLNPEVVQEIMDGAI
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgagcaattaccacattaaaaatttagaagaatactttcaagtttatagaaaatctgtt
cgcgatcctgaaaatttctgggaagaaatagccgaagaaaactttatgtggcgcaaacga
tgggataaagtactggaatatgacctctcaaaacctgaagtttcgtggtataaaggcgca
aaactaaacattactgaaaactgtatagataggcatttatatgcacgtggcaacaaaaca
gccatcatttttgagcccaacaacccttccgaagaagccgaacatatcacctacaaccag
cttcacgaccgcgtttgtcggtttgcaaacgttttgctagaccacggagtaaagaaagga
gatcgagtttgtatttacttaccaatgattcctgaactggcggtttcattattggcctgc
gcgcgtattggcgcaatacattctgtggtttttgcggggttttcttccaccgcacttcac
actcgaattaatgattctgattgcaaaatggtcatcaccagcgacggctcttatcgcggt
ggaaaaacaatagatttaaaaggaattgtagacgaagcaatgaattcctgcccaaacgta
aaaactgttctcgttgctaaacgcatgaattctgaaattacgatgaaagaaggtcgcgat
aagtggcttcaacccttgcttgatgaagctagcaaccaatgtgctccagaaattatggat
gcggaagatccactttttatcctctacacttctggctccaccggaaaaccaaaaggaatg
gttcataccacggctggctatatggttttcacggcttacacttttaaaaacgtattccaa
taccgcgaaaacgatgtttattggtgtaccgcagacattggctgggtcaccggtcacagt
tacatagtttatggtccattggcaaatggcgcaacaactgtactttttgaaggcgttccc
tcctacccagattttggacgtttttggcaagttattgaaaagcataaaattaaccagttt
tataccgcgccaactgcaatacgtgccttggcgaaagaacgtttggatttttcagcaaac
tatgatctttcttcgctcaagattttgggaagcgttggggaacccattaatgaagaggct
tggcactggtacaacgacaatatcgggaagaaaaactgcccaattgtagatacgtggtgg
caaaccgaaacaggcggaattatgatttcgcccattccctactccacaccaactattcct
acctacgctacgcttccattgcctggaattcagcctgcattgatggacgaaaatggcgat
gaactgaaaggaaatttagtgagcggacgtttatgtatcaaatttccgtggccaggaatg
gcgcgaaccatttggaacaatcacgaacggtatcgcgaaacctatttttcaacttttaaa
aataattatttttcaggagatggcgcattaagagacagcacaggctattaccgaattacg
gggcgtgtagatgatgtaattattgtttctggtcacaatttaggaaccgcaccaattgaa
gatgccataaacgaacacccagcagtggcagaaagcgccatcgttggctttccacacgat
gtgaagggaaatgcgctgtacggttttgttattttgaaagaaactggcgaaactcgccta
cacgaaaacttgcgtaaagaaataaaccaaataataaccgaacatattggaccaatagcc
aaactggacaaaatacaattcaccactggcctaccaaaaacccgaagtggaaaaataatg
cgtcgcattttaagaaagattgcagagaaggatactaacaatttgggtgatatctcgaca
ctgctaaacccagaagtggtgcaggaaataatggatggagcgatttag

DBGET integrated database retrieval system