KEGG   Aequorivita sublithincola: Aeqsu_3210Help
Entry
Aeqsu_3210        CDS       T02132                                 

Definition
protein-L-isoaspartate and D-aspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
asl  Aequorivita sublithincola
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3480742..3481383)
Genome map
AA seq 213 aa AA seqDB search
MKDTFTHQGMRKKLVETLSRKGIIDKNVLQAIGKIPRHLFMDSGFVDHAYVDKAFPIAAD
QTISQPYTVARQTELLEVKKGDKILEIGTGSGYQAAVLLEIGATLYTIERQNELFKKTKL
FLPKLGYKPKRLIFGDGYIGLQSEAPFDGIIVTAGAPFVPNPLLAQLKVGGKLVIPVGEN
VQIMTVFLRKSDTEFEKEEYGEFRFVPLLEDKN
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
ttgaaagatacatttacccaccaaggaatgcgtaaaaaattagtcgaaacccttagtagg
aaagggattattgataaaaatgttttgcaagctattgggaagattccgcgccatcttttt
atggattctgggtttgtggaccatgcttatgtagacaaagctttcccgattgctgcagat
cagactatttcgcaaccttatactgttgctcgccaaacagaacttttagaagtgaagaaa
ggtgataaaattcttgaaataggaacggggagtggttaccaagctgcggttcttttagag
atcggtgcaacgctttataccatagaaaggcaaaacgagcttttcaaaaaaacaaaactc
tttcttccaaaacttggttataaaccgaagcgtttgatttttggagatggttatattggt
ttgcaaagtgaagctccttttgatggaattatagttaccgctggagcaccttttgttcca
aatccgttgttggcgcaattgaaagttggcggaaaattagtgattcctgtgggtgaaaat
gtacagattatgaccgtctttttacgcaaatctgacaccgaatttgagaaagaagagtat
ggtgagtttagatttgttcctcttttagaagacaaaaactaa

DBGET integrated database retrieval system