KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0034Help
Entry
MOUSESFB_0034     CDS       T01857                                 

Gene name
recR
Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:asm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
42396..42992
Genome map
AA seq 198 aa AA seqDB search
MIEYPEYIQKVVSEFSKLPGIGYKTAIRLTMHILNREINEINEFCDSVKKCKEKLRYCEK
CNNFSDDDICLICKDTSRDKSTICVVQDVKDVYAFEKIGSYKGLYYVLHGLISPIKGIGP
DDLKIELFVKRVKEEKINEVILATNPTLEGEATSIYISKLFSNEQKLTRLAYGVPLGSDL
EYVDEITLSRALDFRQRI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgatagagtatccagagtatatacaaaaagttgttagtgagttttctaaattacctgga
ataggatataagacagctataagattaaccatgcatattttgaatagagaaataaatgag
atcaatgaattttgtgattctgtaaaaaaatgtaaagaaaaattaagatattgtgaaaaa
tgcaataatttttctgatgatgatatttgtttgatttgtaaggatacgagtagagataaa
tctacaatttgtgttgtacaagatgtaaaagatgtttatgcatttgagaagataggaagt
tataaagggttatactatgtgttgcacggattaatatctcctattaaaggtatcggtccg
gatgatcttaagatagaattgtttgttaagagagtaaaagaagaaaagataaatgaagtt
atattagcgacaaacccaactctcgagggagaggcaactagtatatatatatcaaaattg
ttttcaaatgaacagaaattaactagattagcatatggagtgcctttaggaagcgattta
gaatatgttgatgaaattactttaagtagagctttagattttagacaaagaatttag

DBGET integrated database retrieval system