KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0056Help
Entry
MOUSESFB_0056     CDS       T01857                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MOUSESFB_0056
   00052 Galactose metabolism
    MOUSESFB_0056
   00500 Starch and sucrose metabolism
    MOUSESFB_0056
   00520 Amino sugar and nucleotide sugar metabolism
    MOUSESFB_0056
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MOUSESFB_0056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74207..74986
Genome map
AA seq 259 aa AA seqDB search
MIPILDKPTIHYIVEEAVNSGITDILFVTSKHKKCIEDYFDNFKELENVLELSGNYEMLN
IIKDISNMANISFVRQKEQKGLGHAIYHAKAFVGSDPFCVLLGDDLIYNDNKPCLKQLID
IHDDYGGSVIGVQKVDFKDVDKYGIIDGVEVYKDLYEVKNLIEKPHVDHAPSNIAILGRY
IISPSIFEFLEEGLVGKGGEIQLTDSILKLLTNEKVYAYDFEGIRYDIGNKLGYLEATID
YALRDNSINRDLTRYLKER
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgatacctattttagataaaccgactatacattatattgtagaagaggcggttaattca
ggtattacagatatattattcgttacgagtaaacataaaaaatgtattgaagattatttt
gataattttaaagaattggagaatgttttagagttatctggaaattatgaaatgttaaat
ataattaaagatatatctaatatggctaatataagttttgttagacaaaaggagcagaag
ggattaggtcatgcaatatatcatgctaaagcttttgtgggttcagatccattttgtgta
ttacttggagatgatttaatttacaatgataataaaccttgtttgaaacaattgatagat
atacatgatgattatgggggaagtgtgataggagttcaaaaggttgattttaaagatgta
gataagtatggtattattgatggtgtagaagtttataaggatttatatgaggttaaaaat
ttaattgaaaaacctcatgtagatcatgctccaagtaacatagctattcttggtagatat
ataataagtcccagtatatttgagtttttagaggaaggtttggtaggtaaaggtggagaa
atacaattgactgattctatattaaaattgcttacaaatgaaaaggtatatgcttatgat
tttgaaggaattaggtatgatataggaaataagttaggatatttggaagcaacaattgat
tatgcattaagagataatagtataaatagagatttaacaaggtatttaaaagagaggtaa

DBGET integrated database retrieval system