KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0081Help
Entry
MOUSESFB_0081     CDS       T01857                                 

Gene name
asnB
Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MOUSESFB_0081 (asnB)
Enzymes [BR:asm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     MOUSESFB_0081 (asnB)
Peptidases [BR:asm01002]
 Cysteine Peptidases
  Family C44
   MOUSESFB_0081 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
101731..103572
Genome map
AA seq 613 aa AA seqDB search
MCGITGFSNFNKDIRSEFNNILMMNDSLYHRGPDEFDYYKHKNVVLGHRRLSIVDPNGGK
QPMQRIVNFHKYTIVYNGEIYNTDEIRDDLVSKGYSFYTYSDTEVVLINYIHYKEECVSK
LNGIFAFCIFDEDRNCLFMARDQLGVKPIFYSFKDGYLIFGSEIKSLLKHPKVSPIVCGD
GILDLLGLGPSRSLGEGIFKDVKEIPPAHYLFIYKDRITLKEYWRLESKEHNLTLEDTKE
KLSLMLENAIKKQMVSDRGIFSFLSGGIDSSLISAVVSDEFNKEGKILDTFTVDYVDYDK
DFEGNEFEVTSDKYFVKVVNESIKSNNRIITIKNEDLFYALEDGLYSSDIPSMADIDTSL
YLFCKGIKNYGTVGLSGECADEIFGGYPWYLNEEDLKLNKFPWNRFSGIRKELFNDKIKN
LDFDSYIKNKFDETLKDVCILDSDSELDAKIRKMTTLNVKWFMVTLLNRKDRMSMANSLE
IRVPFADRELVEFSYNIPAKFKFLNGREKGILREVSRKFLPDSIIDRKKSPYPKTQSAIY
TNLVVNELSNILDNKSNPIFEIIDEKSVRKLIESRGNSYTKPWFGQLMRGPQLMAYLIQI
NMWLKKYNINLSL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgggataactggattttccaattttaataaggatataagaagtgagtttaataat
atattaatgatgaatgattcgctttatcatagaggaccagatgaatttgattattataaa
cataaaaatgtggttttgggacatagaaggttatctatagttgaccctaatggtgggaaa
caaccaatgcaaaggattgtaaattttcataaatatacgattgtttataatggtgaaata
tataatactgatgagattagagatgatttggtaagtaaaggttatagtttttatacttat
tctgatacagaagttgtcttaataaattatatacactataaagaagagtgtgtgagtaaa
ttaaatggtatatttgcgttttgtatatttgatgaagataggaattgtttatttatggct
cgagatcagttgggagttaagcccattttttatagttttaaagatggatatttaattttt
ggatctgagataaagtctttgttaaaacatcctaaagttagtcctatagtttgtggtgat
gggatattagatcttttgggtttaggaccaagtcgtagtcttggagaaggtatatttaaa
gacgtaaaggaaataccacctgcacattatttatttatatataaagataggataacactt
aaagaatattggagacttgagtcgaaggaacataatttgactctcgaagatacaaaagaa
aaattatctttaatgcttgaaaatgctataaagaagcaaatggtatcagatagggggatt
ttttcttttctatcaggaggtatagattcatctcttatatcagctgtagtatcagatgaa
tttaacaaagaaggtaagattttagatacatttactgtagattatgtagattatgataag
gattttgagggtaatgagtttgaagttacaagtgataaatattttgttaaagttgttaat
gaatctataaaatcgaataatagaattattacaattaaaaatgaagatttattctatgct
ttagaagatgggctttattcaagtgatattccttctatggctgacattgatacttccttg
tacttattttgtaaaggaattaaaaattatggtaccgttggattatctggagaatgtgca
gatgaaatatttggaggttatccttggtatttaaatgaagaagatttgaagttaaataag
ttcccttggaatagattttcgggtataaggaaagaactttttaatgataagattaaaaat
ttagacttcgattcttatattaaaaataagtttgatgaaactttaaaggatgtttgtatt
ttagatagtgatagtgaacttgatgcaaaaataagaaagatgactactcttaatgttaag
tggtttatggtaactcttttaaataggaaagatagaatgagtatggcaaatagtttggag
ataagagttccttttgcagatagagagcttgttgaattttcttataatattcctgctaaa
tttaaattcctaaatggaagagagaagggtatacttagagaagtaagtagaaaattttta
ccagattctataatagatagaaaaaagagtccttaccctaaaactcaaagtgctatatac
actaatcttgtagtaaatgaattatcaaatattttggataataaatctaatcctattttt
gagattatagatgaaaaaagtgttaggaaattaattgagagtagaggaaattcttatacg
aaaccttggtttggtcaacttatgagagggcctcagcttatggcatatttaatacaaatt
aatatgtggcttaagaaatataatataaatttatctttgtaa

DBGET integrated database retrieval system