KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0083Help
Entry
MOUSESFB_0083     CDS       T01857                                 

Gene name
pfkA2
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00010  Glycolysis / Gluconeogenesis
asm00030  Pentose phosphate pathway
asm00051  Fructose and mannose metabolism
asm00052  Galactose metabolism
asm00680  Methane metabolism
asm01100  Metabolic pathways
asm01110  Biosynthesis of secondary metabolites
asm01120  Microbial metabolism in diverse environments
asm01130  Biosynthesis of antibiotics
asm01200  Carbon metabolism
asm01230  Biosynthesis of amino acids
asm03018  RNA degradation
Module
asm_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOUSESFB_0083 (pfkA2)
   00030 Pentose phosphate pathway
    MOUSESFB_0083 (pfkA2)
   00051 Fructose and mannose metabolism
    MOUSESFB_0083 (pfkA2)
   00052 Galactose metabolism
    MOUSESFB_0083 (pfkA2)
  Energy metabolism
   00680 Methane metabolism
    MOUSESFB_0083 (pfkA2)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    MOUSESFB_0083 (pfkA2)
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MOUSESFB_0083 (pfkA2)
Protein phosphatases and associated proteins [BR:asm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MOUSESFB_0083 (pfkA2)
Messenger RNA biogenesis [BR:asm03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     MOUSESFB_0083 (pfkA2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat WD40_alt
Motif
Other DBs
NCBI-ProteinID: BAK79225
Position
107241..108200
Genome map
AA seq 319 aa AA seqDB search
MKKIAILTSGGDAPGMNAAVRSVVRYALSKDIEVLGIHRGYHGLLHGEIESLSRRSVSDI
IDRGGTFLKTARCLEFKQEEVRAQAYEILKSHNVDGLVVVGGDGSFTGAHLLSKFGLSTV
GIPGTIDNDLPYTDYTIGFDTALNTILDAVRKLRDTSSSHERVSIVEVMGRNCGDLALYS
ALAGGAEAVIVPEYPFNREGLCKTILESKKNKKLHSLIILAEGAGNAEDLRKYIQQKIGL
DTRATVLGHIQRGGIPTGRDRVLASVMGRKAVDTLLSNEVCAKVIGVKENTVFDMDIEEA
LKIEKKFNKDLYDLVNKLV
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagatagcgattttaacaagtggtggagatgctccaggaatgaatgcagctgtt
aggtcggttgtgagatatgctttaagtaaagatatagaggttcttggaatacatagagga
taccatggacttttacacggtgaaatagaatctttaagtagaagatccgtttctgatatt
atagatagagggggaacattcttaaaaactgcaagatgtctcgagtttaaacaagaagaa
gtgagagctcaggcctatgagatattaaaaagtcataatgttgatggacttgtggttgta
ggtggtgatggatcatttactggggctcatttgttatcaaagtttggtttatctacagtt
ggtatacctggaactatagataatgatcttccttacacagactatacgattggatttgat
acagctcttaatacaatattggatgctgtgagaaaattgagagatacatcaagttctcat
gagagagttagtattgttgaagttatgggaagaaattgcggagatttagcattatattca
gctcttgctggtggcgctgaagcggtgattgttcctgagtatccttttaatcgtgaggga
ttatgtaaaactatattagagtctaagaaaaataaaaagcttcatagcctaataatttta
gcagaaggggcagggaatgcagaggatcttagaaagtatatacaacagaaaataggactt
gatactagggcgacagttcttggacatatacaacgtggagggataccgactggacgcgat
agagttttagcatctgtaatgggaagaaaagctgtagatactcttttgagcaatgaagtt
tgtgcaaaagttataggtgttaaagaaaatacagtgtttgatatggatatagaggaagct
ctaaagattgagaagaaatttaataaagatttatatgatcttgttaataaattggtataa

DBGET integrated database retrieval system