KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0176Help
Entry
MOUSESFB_0176     CDS       T01857                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MOUSESFB_0176 (tpiA)
   01230 Biosynthesis of amino acids
    MOUSESFB_0176 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOUSESFB_0176 (tpiA)
   00051 Fructose and mannose metabolism
    MOUSESFB_0176 (tpiA)
   00562 Inositol phosphate metabolism
    MOUSESFB_0176 (tpiA)
Enzymes [BR:asm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     MOUSESFB_0176 (tpiA)
Exosome [BR:asm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   MOUSESFB_0176 (tpiA)
  Exosomal proteins of bladder cancer cells
   MOUSESFB_0176 (tpiA)
  Exosomal proteins of melanoma cells
   MOUSESFB_0176 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
209956..210669
Genome map
AA seq 237 aa AA seqDB search
MHFTIEETEEFLNSLLPKVKNAKTEVVVCPPFTSLALSSNILKGSNVKLGAQNVHFEEKG
AFTGEISPNMLKNLGVSYIIIGHSERRMYFGETDETVNKKIHMCLKHKFNPVLCVGESLE
EKESNNMEKVLTRQIEKAFFNISEEDAKKVVIAYEPIWAIGTGKTATSFDADNIISFIRK
VISGIYNKEVSENIVMLYGGSVKPNTIKEQMSMENIDGALVGGASIVVEDFERIVNF
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atgcattttacaattgaggaaactgaagaatttttaaatagtttgttacctaaagttaag
aatgctaaaactgaagttgttgtgtgtcctccatttacttctcttgctttatcttcaaat
atacttaagggttcaaatgtaaaattaggtgctcaaaatgtacattttgaggaaaaagga
gcatttactggtgaaatttccccaaatatgcttaagaatttaggagtttcttatattata
ataggtcatagtgagagaaggatgtactttggagaaacagatgagacagttaataaaaag
atccatatgtgcttaaaacataaatttaacccagttttatgtgttggagagagtttggaa
gaaaaagaaagtaataacatggagaaagtattgactcgtcaaatagaaaaagcctttttt
aatatatctgaggaagatgcaaaaaaagttgtaattgcatatgaaccaatatgggctatt
ggaactggcaagacagcaacaagttttgatgctgataatataatttcttttataagaaaa
gttattagtggtatttataataaagaagtgtctgagaatatagttatgttatatggtgga
tcagttaaacccaatactataaaagagcaaatgtctatggaaaatatagatggtgctttg
gttggtggagcttctatagttgttgaagattttgaaaggattgttaatttttag

DBGET integrated database retrieval system