KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0459Help
Entry
MOUSESFB_0459     CDS       T01857                                 

Gene name
dxr2
Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MOUSESFB_0459 (dxr2)
Enzymes [BR:asm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     MOUSESFB_0459 (dxr2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(525746..526897)
Genome map
AA seq 383 aa AA seqDB search
MKNISILGATGSIGIQSLDVIKNNPHKFKLNSISIGENITKLREILKHFSPELVCLKNKD
DFERMHAEYPNIKFTYGNEGLLEIATFNKSDTIINSLVGNIGLLPTIYAIESHKNIALAN
KETLVTAGHIINKKIKQYNVELIPLDSEHSAIFQCLNGKTHEDIKNIILTASGGSFRDKT
REELKNVTIEDALKHPNWSMGAKITIDSATMANKGLEIIEAHFLFNVDYQNIKVILHRES
IIHSMVEFNDSSIIAQLGTPDMRVPIQYALTYPDRIQNKNFKPLNFEEISSLNFSKVDLS
RYPCVKMAFDAGKLGGTATTVFNSSNEEAVRLFLTKKISFLDIENLIEKSLSHYGVIENP
DLNTIIELDKEVKSFIYEKSKNI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatttctattctaggagcaacaggctccattggaatacaatctctcgatgtt
ataaagaataacccacacaaatttaaattaaattcaatctctatcggtgaaaatataact
aaacttagagagattttaaaacatttttccccagaacttgtatgcttaaaaaataaagat
gattttgagcgtatgcatgcggaatatccaaatataaaattcacatacggaaacgaagga
ttattagagattgctacatttaacaaatcagatactattataaatagtttagttggaaat
atcggacttcttccaacaatatacgcaatagaatctcataaaaatattgctcttgcaaac
aaagaaacccttgttacagcaggtcacataataaataaaaaaatcaaacaatataatgta
gaacttataccacttgatagtgaacattcagctatctttcaatgtttaaatggaaaaacc
catgaggacataaaaaatataattttaacagcatctggtgggagttttagagataaaaca
agagaagaacttaaaaatgtgactattgaagatgcactaaaacacccaaattggtcaatg
ggggcaaaaataacaatagattctgcaacaatggcaaataaaggacttgaaataatcgaa
gcacactttctattcaatgtagattatcaaaatataaaagtaatactccatcgtgaaagt
atcatacactcgatggtcgaatttaatgattcaagtataatagctcaacttggaactcca
gacatgagggttcctattcaatacgctctgacatatccagatagaatacaaaataaaaat
tttaaaccattaaattttgaagaaatatcctcattaaacttttctaaagtggatttatct
agatatccttgtgtaaaaatggcatttgatgctggtaaacttggaggtacagcaacaact
gtatttaattcttcaaatgaagaggctgttagattatttttaaccaagaaaatatcattt
ttagatatagaaaatttaattgaaaaatctctatcacattatggagttatagaaaatcca
gatttaaataccattattgaactagataaagaagttaaatcatttatttatgaaaaatca
aaaaatatttaa

DBGET integrated database retrieval system