KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0522Help
Entry
MOUSESFB_0522     CDS       T01857                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MOUSESFB_0522
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MOUSESFB_0522
Enzymes [BR:asm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MOUSESFB_0522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
609162..610379
Genome map
AA seq 405 aa AA seqDB search
MVFILKRVLILVFLGLFTLGSCSYYYKKDETYISVKVSEPDEILERINAMSLDEKIGQLF
IVGFDGGSYLTQEDISLIRDYKVSGFIFFRRNIQTSDQVVKLINEIKSVNNAECTVPMFL
SLDQEGGTVTRLPDEIIKFNRAHDIGKLNDENYAYDVAKLMGEIIHSLGFNMNFAPVLDV
YTNSENMVIGSRSFSSDKEVVAKLGIATMNGLKDNGIIAVGKHYPGHGDTKEDSHYELPV
LDHDYERVKGVEIYPFKMAIENGIDSILVSHLFYKNIDPENIVTLSKVFLYDILRKDLKF
RGLVITDDMIMKGLTNHISIPEACFEAFKAGVDVLLIGSGYQNIVESINYIKQSVLNGKI
QEFEIDRKLYNILRIKQKYNVNNDSVSRINVNEFNDKIRSLIDKN
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atggtttttatattaaaaagggttttgatcctagtatttttgggtttgtttactttgggt
tcttgctcatattactataagaaagatgaaacatatatttcagtgaaagttagtgagcca
gatgaaatattagagagaataaatgctatgagtttagatgagaagattgggcaattattt
atagttggatttgatggtggatcatatttaactcaagaggatatttctcttataagagat
tataaagtttctggatttatattttttaggagaaatattcaaacttctgatcaggttgtt
aaacttattaatgaaattaagagtgttaataatgcagaatgtactgttccgatgtttctt
tcattagatcaggaaggtgggactgtcacaagacttcctgatgaaattattaaatttaat
cgtgcacatgatattggaaaattaaatgatgaaaattatgcttatgatgttgcgaagctt
atgggtgagataatacatagtttagggtttaatatgaattttgctccagttttagatgta
tatactaattctgaaaatatggttatcggatcaagatctttttcttcggataaggaagtt
gttgcgaaattgggaatagctactatgaacggacttaaagataatggcattattgctgta
ggaaaacattacccaggtcatggagatacgaaagaggattctcattatgaattgcctgta
cttgatcatgattatgagagagtgaagggtgttgagatttatccgtttaaaatggctata
gaaaatggtattgattcaattttagtatcacatttattttataaaaatattgatccagag
aatattgttactctgtctaaagtttttttgtatgatatacttaggaaagatttaaaattt
agagggcttgttataacagatgatatgataatgaaaggacttactaaccatatttctatt
cctgaagcttgttttgaagcttttaaggctggtgttgatgtgttacttattggatcagga
tatcaaaatatcgtagaatctattaattatattaaacaatcagttttaaacgggaaaatt
caggagtttgaaatcgataggaaattgtataatattttaaggattaaacaaaagtataat
gtaaataatgacagtgtatcaaggattaatgttaatgaattcaatgataaaataagaagt
ttaatagataaaaattaa

DBGET integrated database retrieval system