KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0529Help
Entry
MOUSESFB_0529     CDS       T01857                                 

Gene name
cheB
Definition
response regulator receiver modulated CheB methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:asm00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MOUSESFB_0529 (cheB)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MOUSESFB_0529 (cheB)
Enzymes [BR:asm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MOUSESFB_0529 (cheB)
Two-component system [BR:asm02022]
 CheA family
  CheA-CheYBV
   MOUSESFB_0529 (cheB)
Bacterial motility proteins [BR:asm02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MOUSESFB_0529 (cheB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614336..615370
Genome map
AA seq 344 aa AA seqDB search
MGKIGKNLKYRDQIIKTKLIIYDESNLMRKLVYDRLAKDAGINIIDIFDDYDEMKNFILG
SGIVLDVIILNQSFYENGDFIKYLLDLKNFAVNLIVISNLDDSTISFIERTVGAEKLIFI
RCLNKSGLKDIFDIKEKLIDVVYGIKNSRIKRAIFDVQKAIVIASSTGGPKVLEYIFGNL
ETKIDMPVFIVQHMPEGHTKHFIDRLGELCSYKVCEGKNGEIAMANVVYVAPSGYHMEID
NKKQINLNVNKPLNNVRPSADALFCSASKIYKKGLLGIVLTGMGRDGSDGIRYIKINGGI
TIAQDEGSSTVFGMPKSAIETGMVDKVLSKDEILFEIVKHSGKL
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagataggcaagaatttgaaatatagagatcaaattataaaaacaaaacttatt
atatatgatgaatcaaatttaatgagaaaacttgtatatgacagattggctaaggacgct
ggaataaatattatagatatttttgatgattatgatgaaatgaaaaatttcatcttgggt
tcaggcattgtattagatgtaataattttgaatcaatcgttttatgagaatggagatttt
attaaatatttattagatttaaaaaattttgctgttaatttaatagtaatatcgaatctt
gatgacagtacaatttcatttatagagcgaactgtaggagctgaaaaattaatatttata
agatgtttaaataaatcaggattaaaagatatttttgacataaaagaaaaattgatagat
gtagtctatggaataaaaaatagccgtattaagcgtgctatatttgatgtgcaaaaagct
atagtaattgcatcatcaacgggtggaccaaaagtgttagaatatatatttgggaatttg
gaaaccaaaatagatatgcctgtatttatagttcaacatatgccagaaggtcatacgaaa
cactttattgatagattgggtgaactttgtagttacaaagtttgtgaagggaaaaatgga
gaaattgcaatggctaatgtggtttatgttgcaccaagtggttatcatatggaaattgac
aacaaaaaacagattaatttaaacgttaacaaaccattaaataatgttagaccatctgct
gatgctttgttttgttcagcatctaagatttataaaaaaggtcttttaggaatagtacta
actggaatgggtagagatggttctgatggaattaggtatataaaaataaatggagggatt
actatagctcaagatgagggaagtagcactgtttttggaatgcctaaatcagcaattgaa
actggaatggtagataaagttttatcaaaagatgaaatattatttgagattgttaaacat
tcaggtaaactatag

DBGET integrated database retrieval system