KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0556Help
Entry
MOUSESFB_0556     CDS       T01857                                 

Gene name
gpk
Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00230  Purine metabolism
asm01100  Metabolic pathways
Module
asm_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    MOUSESFB_0556 (gpk)
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     MOUSESFB_0556 (gpk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_18 Rad17 AAA_17 AAA_22 MMR_HSR1 Cytidylate_kin AAA_16 dNK ADK RsgA_GTPase ABC_tran RNA_helicase AAA KTI12 NTPase_1 TsaE AAA_5
Motif
Other DBs
NCBI-ProteinID: BAK79698
Position
639295..639912
Genome map
AA seq 205 aa AA seqDB search
MDEMYNKGLLIVLSGPSGVGKGTVCKELMKKYDYKVSISATTRSPREGEVDGVNYYFLDK
DTFKSKIENNEFLEYAEVYGNYYGTLKSQVEEELSRGNNIILEIDIQGSMQVQSVFENAV
YIFLLPPSINELKSRILKRGSETESSFNLRFSSVSEELKCMVNYDYAVINDDVEGAVEKI
NGIIRTEMSRISRMNLEKFIGGYIF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatgtacaataagggattattgattgttctttctggaccttctggtgtcggg
aaaggtacggtttgtaaagaacttatgaaaaagtatgattataaggtttctatttctgct
actactaggtctccgagagaaggagaagttgatggagttaattattattttttagataag
gatacctttaaatcaaagattgaaaataatgaatttttagagtatgctgaagtttatggg
aattattatggtacgcttaaaagtcaagttgaagaagagttaagtagagggaataatatt
atacttgagattgatattcaggggagtatgcaggtgcaaagtgtttttgaaaatgcagtg
tacatatttttattaccaccgtctataaacgagcttaaaagtaggattttgaaaagagga
agtgaaactgaatcttcgttcaatttaagattttcttcagttagtgaagaattaaaatgt
atggttaattatgattatgcagttataaatgatgatgttgagggtgcagttgagaaaata
aatggtataataaggactgaaatgagtagaataagtagaatgaatttagaaaaatttatt
ggtggatatattttttag

DBGET integrated database retrieval system