KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0556Help
Entry
MOUSESFB_0556     CDS       T01857                                 

Gene name
gpk
Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:asm00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
639295..639912
Genome map
AA seq 205 aa AA seqDB search
MDEMYNKGLLIVLSGPSGVGKGTVCKELMKKYDYKVSISATTRSPREGEVDGVNYYFLDK
DTFKSKIENNEFLEYAEVYGNYYGTLKSQVEEELSRGNNIILEIDIQGSMQVQSVFENAV
YIFLLPPSINELKSRILKRGSETESSFNLRFSSVSEELKCMVNYDYAVINDDVEGAVEKI
NGIIRTEMSRISRMNLEKFIGGYIF
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatgaaatgtacaataagggattattgattgttctttctggaccttctggtgtcggg
aaaggtacggtttgtaaagaacttatgaaaaagtatgattataaggtttctatttctgct
actactaggtctccgagagaaggagaagttgatggagttaattattattttttagataag
gatacctttaaatcaaagattgaaaataatgaatttttagagtatgctgaagtttatggg
aattattatggtacgcttaaaagtcaagttgaagaagagttaagtagagggaataatatt
atacttgagattgatattcaggggagtatgcaggtgcaaagtgtttttgaaaatgcagtg
tacatatttttattaccaccgtctataaacgagcttaaaagtaggattttgaaaagagga
agtgaaactgaatcttcgttcaatttaagattttcttcagttagtgaagaattaaaatgt
atggttaattatgattatgcagttataaatgatgatgttgagggtgcagttgagaaaata
aatggtataataaggactgaaatgagtagaataagtagaatgaatttagaaaaatttatt
ggtggatatattttttag

DBGET integrated database retrieval system