KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0647Help
Entry
MOUSESFB_0647     CDS       T01857                                 

Gene name
rbsK
Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MOUSESFB_0647 (rbsK)
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     MOUSESFB_0647 (rbsK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(729114..730043)
Genome map
AA seq 309 aa AA seqDB search
MNKVCVLGSLNMDLVLKVNDIPKIGETILSNSYEKIAGGKGANQAIAAKRCGADVSMIAK
IGKDENGRILKGKLKEDGIDVSCIFEDEQNPTGLALIMVNKNGNNSIIVVPGSNMKINDS
EINKSISKIKESDILIAQFETNEEMTLKSFQKAKEFNKITILNPAPAKKIDIELLKLTDI
IIPNETEAEVLTRIKITSIDDAKRAGKFFINQGVKFAIITLGENGALIIGNDFYELVKSF
KVNAVDTTAAGDSFIGALSSKLNFKNLTRETLKESVYFGNKVSSITVQRKGAQPSIPYLE
EVKKIYKEN
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagtatgtgttcttggaagtttaaacatggacttagttttaaaagttaatgat
ataccaaaaataggagagactatcctatctaactcatatgaaaaaatagcaggaggtaaa
ggagcaaatcaagcaatcgctgccaaaagatgcggtgctgatgtttccatgatagctaaa
ataggaaaagatgaaaatggtagaatattgaaaggaaaacttaaggaagatggaatagac
gtaagttgtattttcgaagacgaacaaaatccaactggacttgctttgattatggtaaat
aaaaacggaaataattcaataatagttgttccaggttcaaatatgaaaattaatgatagt
gaaataaataaatcaatttcaaaaattaaagaatcagatatactaatagcacaatttgaa
actaatgaagaaatgactttaaaatcttttcaaaaagcaaaagagttcaataaaataact
atacttaatccagctccagcaaaaaaaatagatattgagctattaaaattaacagacatc
ataatacctaatgaaacagaggctgaagtcttaacaagaatcaaaataacttctatagat
gatgctaaaagagcaggaaaatttttcataaaccaaggagttaaattcgcaataattaca
ttaggagaaaatggagctcttatcataggaaacgatttttacgaattagtaaaatcattt
aaagtaaatgctgtagacacaactgcagctggtgatagttttataggagctttaagttca
aagttaaatttcaaaaatttaactagagaaacattaaaagaatctgtatattttggaaac
aaagtatcttcaataactgtacaaagaaaaggtgctcaaccatctataccttatcttgaa
gaagtaaaaaagatttataaggagaattaa

DBGET integrated database retrieval system