KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_0659Help
Entry
MOUSESFB_0659     CDS       T01857                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:asm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
742166..743581
Genome map
AA seq 471 aa AA seqDB search
MKQKFPENFLWGASSSAFQIEGGWDEDGKGKTVADFNSFKRSDKQADTKVASDFYHHWKE
DIAMMKELGMQIYRFSLSWARIVPDGDGDINAAGIDFYNKVIDELIANGIQPFVTLYHFD
LPYALVEKYNGWECRNCAFAFERYARVCFKEFGDRVKYWQVINEQNLMIRVNERMNIYVD
DLWEADRIRAQMDYHMFLGHALAVNSCHELVEGGKVGPAVSSTCTYPLTNKPEDVWAAKM
NDWLKTNYCLEMHINGEYPGYYMRYLRERNIVPKMEPEDVAILKSAKIDYIALNYYRTLC
ASYLPASEEHPIGERVYRDNEVDFDQYGYCRNEKNANLSASEYGAQIDPMGLRIVLNEYY
RRYHLPMIITENGLGMADVLTEDGKVHDSYRIDYIRSHIQACANAIEDGVELIGYSPWSV
MDLLSSHQGFRKRYGFIYVDRDDFDVKQLRRIKKDSFYWYKHVIETNGEEL
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaaaatttcctgaaaattttctttggggtgcatcttcatccgcttttcaaatc
gaaggtggatgggacgaggatggaaaaggtaaaactgttgctgactttaattctttcaag
cgttccgacaaacaggctgatactaaggtagctagtgatttttatcaccattggaaagaa
gatatcgctatgatgaaagaactgggaatgcagatttatcgcttttctctttcctgggct
agaattgttccagatggtgacggcgatattaatgcggctggtattgacttctataacaaa
gtaatcgatgagttgattgccaatggtattcagccgtttgttacattatatcatttcgat
ttgccttatgcactggtagagaagtacaacggatgggagtgccgaaactgtgcgtttgct
tttgaacgctacgcacgggtgtgctttaaggagtttggcgaccgtgtcaaatattggcag
gttatcaatgagcagaatttgatgattcgtgttaacgagcggatgaatatctatgttgat
gatttgtgggaagctgatagaattcgggctcagatggactaccatatgttcctgggtcac
gccttggctgttaactcttgtcatgaactagtggaaggcggaaaggtaggtccagcagtg
tcttccacttgtacttatccattgaccaataagccggaggatgtctgggcagctaagatg
aatgattggctcaaaactaactattgtttggaaatgcacattaacggtgaatatcctgga
tattatatgcgctatttacgagaacgtaatattgtaccgaagatggagccagaggatgtg
gcaattctgaaaagtgcaaagattgattatattgcactaaactattaccgaaccctctgt
gctagttatctacctgcatcggaggaacatccaattggcgaacgagtttatcgggataat
gaggttgactttgatcagtatggatactgccgtaatgagaaaaacgcaaatctttctgca
agcgaatatggtgcacaaatagatccgatgggtcttcgtattgtacttaatgagtactat
cgccgttatcatcttcctatgattatcacggaaaacggactaggaatggcagacgtattg
acagaggatgggaaggtgcatgactcttaccgtatcgattatatacgaagtcacatccaa
gcctgcgcgaatgcgattgaggatggtgtggagttaattggctatagtccttggtctgta
atggatctgttgagctcccaccagggtttccgcaaacgttacggtttcatctatgtggat
cgggacgattttgatgtgaagcaacttcgacgtataaaaaaagacagtttctattggtat
aagcacgtaattgagaccaacggcgaagaactgtaa

DBGET integrated database retrieval system