KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_1140Help
Entry
MOUSESFB_1140     CDS       T01857                                 

Gene name
rocF
Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
asm00220  Arginine biosynthesis
asm00330  Arginine and proline metabolism
asm01100  Metabolic pathways
asm01110  Biosynthesis of secondary metabolites
asm01130  Biosynthesis of antibiotics
asm01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    MOUSESFB_1140 (rocF)
   00330 Arginine and proline metabolism
    MOUSESFB_1140 (rocF)
Enzymes [BR:asm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     MOUSESFB_1140 (rocF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Clathrin_propel
Motif
Other DBs
NCBI-ProteinID: BAK80282
Position
1288443..1289336
Genome map
AA seq 297 aa AA seqDB search
MNLNIITVSTFYGCDKKGVELGPKALINNNLLSIIKNCGHTINEIIDIPVDIDNKNKFDN
NKQIKYFDKVKTIVKNLSISIEESYKNNTFPLVLGGDHAISIGSLAGFSKSFKNTGVIWI
DAHGDLNIPSSSPSYNAHGMPLACSLGYGHEEFISIFKKNIDPKNVFLFGIRSLDNWEKE
FIIKNEMHIYDRNSFDQIPQDLMIDTLKKYTNKNKIENFHLSFDIDVFDPLIAPGTGTPV
KKGLLMDEVKNLMSKLLSSINIVSIDFVEFNPLLDKDNKTLTACLEILEFIFRRIKK
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaaatataataactgtttccacattttatggatgtgataaaaaaggagttgaa
ctaggacctaaagctctaatcaacaataatcttttatctattatcaaaaattgtggacac
acaataaatgaaataatcgatataccagtagatatagataataaaaataaatttgataat
aataaacagattaaatactttgataaagttaaaactatagttaaaaatctttccatctca
attgaagaaagctataaaaataatacatttccactagttttaggtggagatcatgccata
tctatcggatcactagctggtttttctaaaagtttcaaaaatactggagtaatctggata
gatgctcatggcgatttgaatatcccaagttcatcgccttcatacaatgcccacggaatg
ccactcgcatgctcacttgggtatggtcatgaagaatttatatcaatatttaaaaaaaat
attgatcccaaaaatgtatttctatttggcatacgatctcttgataattgggaaaaagaa
tttataatcaaaaatgaaatgcacatatacgatagaaattcatttgatcaaattcctcaa
gacttaatgattgatactttaaaaaaatatacaaataaaaataagattgaaaacttccac
ttatcatttgatattgatgtatttgatcctttaatcgcacctggtaccggtactccagtc
aaaaaaggattgttaatggatgaagttaaaaatcttatgagtaagttgttatcttccata
aatatagtttcaatagattttgttgaatttaaccctctactcgataaagataataaaacc
cttactgcttgccttgaaattcttgaatttatatttaggaggataaaaaaataa

DBGET integrated database retrieval system