KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_1144Help
Entry
MOUSESFB_1144     CDS       T01857                                 

Definition
phosphofructokinase family protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:asm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MOUSESFB_1144
   01230 Biosynthesis of amino acids
    MOUSESFB_1144
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MOUSESFB_1144
   00030 Pentose phosphate pathway
    MOUSESFB_1144
   00051 Fructose and mannose metabolism
    MOUSESFB_1144
   00052 Galactose metabolism
    MOUSESFB_1144
  Energy metabolism
   00680 Methane metabolism
    MOUSESFB_1144
Enzymes [BR:asm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     MOUSESFB_1144
Protein phosphatases and associated proteins [BR:asm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MOUSESFB_1144
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1291928..1293067)
Genome map
AA seq 379 aa AA seqDB search
MLQLISVYSDIGRITMNQIKKIAILTGGGDCPGLNAVIRAVTKTAILEYGYEVIGYRFGY
RGLYNNDYINLDINAVDNILHKGGTILWSSNKDNLFDYIVEENGQKVKKDVSDIAVDNLK
KENIDALVIVGGDGTLTSARDFARKGVNVVGVPKTIDNDLGATDFTFGFNTAIGIVTDCL
DRLHTTAESHHRILIAEVMGRNAGWIALHAGIAGDAHIILIPEIPYNLDKIVEKINERKA
MGYKYTLIVVSEGAKSVLGETVIAKVVEDSPDPIRFGGIANKLAIDLEKRIPDQEVRSTI
LGHIQRGGNTSTYDRILSTRYGAAAARLIYEGKFGNMVCLDGDEISCIKLEGVIGNEKFV
NPDHELIKISKSMGIGFGD
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgttacaattaatctcagtgtactcagatattgggaggattactatgaatcaaataaag
aaaattgcgatacttacaggtggaggagactgtccaggtcttaatgcagttataagagca
gtaacaaaaacagctatattagaatatggatatgaagttatagggtataggtttggatat
agaggtttgtataataatgattatattaaccttgatattaatgcagttgataatatctta
cataaaggtggaactatactttggagttccaataaagataatctttttgattatatagta
gaggaaaatggacaaaaagttaagaaagatgtttcagatatcgctgttgacaatcttaag
aaagaaaatattgatgctttggttatagttggtggagatgggactcttacatcagcgaga
gattttgcccgtaaaggtgttaatgttgtaggtgtacctaaaactattgataatgattta
ggagctacggattttacatttgggtttaatacggcgatagggatagttactgattgtttg
gataggctccatacaacagctgaatcacatcatagaattttaattgctgaagttatgggt
agaaatgcagggtggattgctcttcatgctggaattgctggagatgctcatataatttta
atacctgagataccgtataatttggataaaattgtagagaagattaatgaaagaaaagct
atgggatataaatatactttaatagtcgtatccgaaggagctaagtcagttttaggagaa
actgttattgcaaaagttgttgaggattctccagatccaataaggtttggtggaatagca
aataagcttgcaattgatctagagaagagaataccagatcaggaggttagatcaacaata
cttggtcacattcaaagaggagggaatacttcaacatacgatagaattttatctactaga
tatggtgctgcagcagctagacttatttatgaaggaaagtttggtaatatggtttgttta
gatggtgatgaaatttcgtgtataaagcttgaaggtgttattggaaatgaaaaatttgtt
aatcctgatcatgaattaataaagatatctaagagtatgggaattggatttggagattaa

DBGET integrated database retrieval system