KEGG   Candidatus Arthromitus sp. SFB-mouse-Yit: MOUSESFB_1179Help
Entry
MOUSESFB_1179     CDS       T01857                                 

Gene name
recD
Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
asm  Candidatus Arthromitus sp. SFB-mouse-Yit
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:asm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MOUSESFB_1179 (recD)
Enzymes [BR:asm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     MOUSESFB_1179 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1339157..1341397)
Genome map
AA seq 746 aa AA seqDB search
MRGRMKKLIGAIKNIIYTSVKFSIFILVDDEGKEIICVYNDNNINRNDYVEVNGNFEING
KYGERFKVSFLEKRILSVTNDIESYLSSSLFVGIGRKTAKKIIEKFGDQTLDIINNYTER
LKEVEGIGEKKFLEIKSALNRDKNDKEIILDLINIGFSLNNANKIYSLFREEAVNIIRED
PYMLIGKINGFGFKKVDLIGKKLNIPNENSNRVRSGIFYVLKDNLKFGNTFILYNEMIEK
SKELLCISEEKIIEVYNDILSCGIIVEKEFNYENSNIKCVFLTNIYMAEYEICSNLIRLY
IGYKDKFNIDIYRDILEFENKNDFKFSEDQIEALVGGIKNGVHIITGGPGTGKTTIIKFI
LSTLLNYGFNPIMVAPTGRAAKRMMETTGFEAKTIHRVLEISTSDNEEFGYIGKNENNKI
KCDAIIIDEASMVDVLIASKLFEALKIGTKIVIVGDVDQLPSIGPGNFLRDIINSGIFPV
SYLNKIYRQKQNSFIVLNAHKINNGEELILNKKDSDFYIIKDSSEENICKILVDLVSFRI
PKFFEYKIDKLKDIQILSPIRGGVLGVSNLNSLLQENINPKDINKDELIYGGKCYRVGDK
VMQIKNNYEIRGYNIHDEEQAIGVFNGDIGYIIDINEKELSIIYDDSKVFKYTKNLLSEI
EHAYAITIHKSQGSEFPVIILPIFKFSSMLMNRNILYTAVTRAKKYVVLVGDINYLTYMI
KNTSKIIRYSSLKYLFNEVINLLDKN
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atgaggggacgaatgaaaaaattaataggtgctattaaaaatattatttatacttctgtt
aagttctctatatttatacttgtagacgatgaaggtaaagaaataatatgtgtatataat
gataataatattaatagaaatgattacgtggaagttaatgggaattttgaaatcaatggt
aaatatggtgagagatttaaagtttcctttttagagaagaggattttaagtgttacaaat
gacatagagagttatttatcgtcttctttatttgttggaattggtaggaaaacagctaag
aaaataattgagaagtttggagatcaaactcttgatataataaataattatactgaaaga
ttaaaagaagttgaaggtattggggaaaagaagttcttagagataaaaagtgctttgaat
agagataaaaatgataaagagataattttagatcttataaatattggattttctttaaat
aatgcaaataaaatttatagtttatttcgtgaagaagctgtaaatattattcgtgaggat
ccatatatgcttataggaaagattaatggatttggatttaagaaggtggatttaatagga
aagaaactaaatataccaaatgagaattcaaatagggttagaagcggtatattttatgtg
cttaaggataatttgaaatttggaaatacatttatattatataatgagatgattgagaaa
agtaaagagttattatgtatttctgaagaaaaaataattgaagtttataatgatatttta
tcatgtggtattattgtagagaaggaatttaactatgaaaatagtaatataaaatgtgtt
tttttgacaaacatatatatggcagaatatgagatatgttcaaatttaattaggttatat
ataggatataaggataaatttaatattgatatctatagagatatacttgagtttgagaat
aagaatgattttaaattttcggaagatcagattgaggcactagttggcggtataaaaaat
ggtgtgcatataataacgggtggacctggtacagggaaaacaactataataaaatttatt
ttaagcacacttcttaattatggatttaatccaataatggttgcaccaactgggagagca
gcaaaaagaatgatggaaactacaggatttgaagctaaaactatacatagagttcttgaa
atttcaactagtgataatgaagagtttggatatatagggaaaaatgaaaataataaaata
aagtgtgatgctataataatagatgaagcatcaatggttgatgttttgattgcaagcaaa
ttatttgaagcattgaaaataggaacaaagatagtaatagttggagatgttgatcaactt
ccatcaattggtcctggaaattttttaagagatataataaacagtggtatatttccagtt
tcatatttaaataaaatatataggcaaaagcaaaatagttttatagttttgaatgctcat
aagattaataatggagaggaacttatattaaacaaaaaagatagtgatttttatattata
aaagatagtagtgaggagaatatatgtaaaattttagtagatttagtatcttttaggata
cctaaattctttgaatataagattgataagttaaaagacatacagattttatctccaata
agaggaggagtattgggagtttcaaatcttaatagtttacttcaagagaacataaatcca
aaggatattaataaggatgaattaatatatgggggaaaatgttatcgagttggagataag
gttatgcagattaaaaataattatgagattagaggatataatatacatgatgaagaacaa
gcaataggagtgtttaatggggatattgggtatattatagatataaacgaaaaagaatta
agtattatatatgatgacagtaaggtgtttaaatatacaaagaatttattaagtgaaatt
gaacatgcttatgctattactatacataaaagtcaagggagtgaatttccagttattata
ttgcctatatttaaattctctagtatgctgatgaatagaaatatattgtatacagcggtt
actagagctaaaaaatatgttgtattagttggtgatataaattatttaacatatatgata
aaaaatacttcaaagattattagatattcatctttaaaatacttatttaatgaagtgatt
aatttattagataaaaattag

DBGET integrated database retrieval system