KEGG   Alligator sinensis (Chinese alligator): 102367858Help
Entry
102367858         CDS       T02922                                 

Gene name
ALPI
Definition
alkaline phosphatase, intestinal
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:asn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    102367858 (ALPI)
Enzymes [BR:asn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     102367858 (ALPI)
Exosome [BR:asn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102367858 (ALPI)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 506 aa AA seqDB search
MPCPPCAPEEAEKHPLFWNQQASKAIQAALALQPKHYPAKNLILFLGDGMGVPTITATRI
LKGQLQGKLGPETPLVMDTFPYVALSKTYNVDRQVPDSAGTSTAYLCGVKGNYETIGLSA
AARVSQCNTTSGNEVESVLQRARRAGKSVGIVTTTRVQHASPAGTYAHVVNRNWYADSSM
PLDAQREGCQDIAVQLARYADFNVILGGGRKYMFPSDTPDPEYPKENGTRRDSRNLVAEW
LAARPGAKYVWKKADMISASQDLAVTYLMGLFEPADMKYEFNRNQTLDPSLAEMTEVAIR
ILSRNPKGFYLFVEGGRIDHGHHDGIAKAALMEAVEFDKAIQQADELTDEAKTLTVVTAD
HSHVFSFGGYTLRGSSIFGLAPSKAADNKSYTSILYGNGPGYPYPAPSRPDVLRSAVEDN
AYQQQAAVPLDSETHGGEDVAILAKGPMAHLFHGVQEQTYVAHVMAYAACLDPYQDCGLP
DTSGAACAGAGALPALLAALLLWVLT
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgccctgtcccccgtgtgcccctgaagaggcggagaagcatcccttgttctggaaccag
caggcatccaaagccatccaggccgccctcgccctccagcccaagcactacccggccaag
aacctcatcctcttcctgggcgatgggatgggggtccccaccatcacggccacgcggatc
ctgaaggggcagctccagggcaagctgggccccgagacgccgctcgtcatggacaccttc
ccctacgtggcactctccaagacctacaacgtggaccggcaggtgccggacagcgcgggc
acttccacggcctacctgtgcggggtgaagggcaactacgagaccatcgggctgagcgca
gccgcccgcgtctcgcagtgcaacaccacgtcgggcaacgaggtcgagtccgtgctgcag
agagccaggagggccgggaagtcagtggggatcgtgaccacgacacgggtgcagcatgcg
tcgcctgctggcacctatgcccacgtggtcaaccggaactggtacgcggactccagcatg
cccctggacgcccagcgtgagggctgccaggacattgccgtgcagcttgcccgctacgcg
gacttcaacgtgatcctggggggcgggcggaagtacatgtttccctctgacacgccggac
cccgagtacccgaaggagaacgggacgcgcagggacagcaggaacctcgtggctgaatgg
ctggctgccaggccgggggccaagtacgtgtggaagaaagcggatatgatcagcgccagc
caggacctggccgtgacgtacctgatgggcctgtttgagccagccgacatgaagtatgag
ttcaaccgcaaccagacgctggacccgtccctcgccgagatgacggaggtggccatcagg
atcctgagcaggaaccccaagggcttctacctcttcgtggaaggaggcagaatcgaccac
gggcaccacgatggcatcgccaaggcagcgctgatggaggccgtggagtttgacaaggcc
atccagcaggccgacgagctgacagacgaggccaagaccctcactgtggtcacggccgac
cactcgcacgtcttcagcttcggcggctacacgctgcgcggctcctccatcttcggcttg
gcaccctccaaggctgcggacaacaagtcgtacacgtccatcctctacgggaacgggccc
ggctacccatacccggcacccagccgtcccgatgtcctgaggagcgctgtcgaagacaat
gcctaccagcagcaggcggccgtgcccctggactcggagacgcacggcggggaggacgtt
gccatcctggccaagggccccatggcccatctcttccacggggtgcaggagcagacctac
gtggcccacgtcatggcctatgccgcctgcctggatccctaccaggactgcggtctgccg
gacacctccggggctgcctgcgccggcgccggcgccttgcccgccctgctggctgccctc
ctcctgtgggtgctgacttag

DBGET integrated database retrieval system