KEGG   Alligator sinensis (Chinese alligator): 102367884Help
Entry
102367884         CDS       T02922                                 

Gene name
KAT2B
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102367884 (KAT2B)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102367884 (KAT2B)
Transcription machinery [BR:asn03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102367884 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 738 aa AA seqDB search
MMTLSPQLAEESCKCNGWKNPNPPPTPPRADLQQTIVSLTEPCRSCSHPLASHVSHLENV
SEEEMNRLLGIVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLESP
PFEKPSIEQGVNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLEIPSQRRLRSPNDD
IAGYKVNYTRWLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKL
PQEKRTLILTHFPKFLSMLEEEVYSQNSPIWDQDFMMSSSRTGQLGIQTVINPPPVARSI
SYSASPSSLEQPNSGSMSPACKVSSGLDQNLGEKRKNTELYSLEDSKRPRVVGDIPIELI
NEVMSTITDPGAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMW
LVGLQNVFSHQLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFC
AVTSNEQVKGYGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYV
GYIKDYEGATLMGCELNPXXXYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDG
VRQIPIESIPGIRETGWKPSGKERGKESKDPDQLYSTLKTILQQVKSHQSAWPFMEPVKR
TEAPGYYEVIRFPMDLKTMSERLKNRYYVTKKLFMADLQRVFTNCREYNPPESEYYKCAN
ILEKFFYTKIKEAGLIDK
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgatgactctttctccccagctggctgaagaatcctgtaaatgtaatggctggaaaaat
ccgaatccacctcctactcctcccagggcagatctgcaacagacaattgtcagtcttact
gaaccatgccgcagttgtagtcatccactagcttctcatgtgtctcacttagagaatgtg
tctgaagaagaaatgaataggctgttgggaatagtgttggatgtggaatatcttttcacc
tgtgtccacaaagaagaagatgcggacaccaaacaagtttacttttacctgttcaagctt
ttgaggaaatgcattttacagatggggaaacctgtagtagaaggatctttggaaagccct
ccatttgaaaagcccagtattgaacagggggtgaataattttgtgcagtacaaatttagc
cacttaccatcaaaggaaaggcaaacaatagttgagctagctaaaatgtttttaaaccgc
attaactactggcacctggagataccatctcaacgaagattgagatcacctaatgatgat
attgctggctataaagtaaattacacaaggtggctttgttactgtaatgttccccagttc
tgtgacagtctacctcggtacgaaacaacacaggtgtttgggagaacactactccgctct
gtctttactgttatgaggcgccaactcctggaacaggctagacaggaaaaagacaagctt
cctcaggagaaacgaacactaattctcacccattttccaaagtttttatccatgttagaa
gaagaagtttatagtcaaaattctcctatttgggatcaggatttcatgatgtcctcttct
cgaactggtcagctaggaatccaaacagtgatcaatcctcctcctgtggcaaggtcgatt
tcgtacagtgcaagtccttcatctcttgaacaacccaacagtggaagtatgagtcctgct
tgtaaggtttcttctggtcttgaccaaaacctaggggagaagagaaagaacactgagctt
tattctctggaggattccaaaaggccaagagttgtaggagatattcctattgaattgatc
aatgaggtgatgtcaacaattacagatccgggtgcaatgctggggccagagactaacttt
ctgtcagcgcactcagcccgggatgaagctgcgagactggaggagcgcaggggagtgatt
gaatttcacgtagttggaaattccctgaatcagaaaccaaacaaaaagattatgatgtgg
ctagttggcttacagaatgtattttcccatcagctacctagaatgccaaaggaatatatt
acacgcctggtctttgatccaaaacacaagacacttgcattaataaaagatggccgtgtg
attggtggtatctgtttccggatgttcccatctcaaggatttacagagattgttttctgt
gctgtgacttctaatgaacaagtcaagggttatggaactcatctgatgaatcatctgaaa
gaatatcacattaaacataacattctcaacttcctcacatatgcagatgaatatgcaatt
ggctacttcaaaaaacaaggcttctccaaagatattaaagtaccaaaagcaaaatatgtt
ggctacatcaaggattacgaaggagctacattaatgggatgtgaattaaatccannnnnn
nnctacactgaattttctgtcatcattaaaaagcaaaaagagatcataaaaaagctgatt
gaaaggaaacaagctcagattcgaaaagtctatcctggtctttcctgcttcaaggatggc
gtacgacagattcctattgaaagcattcctggaattagagagactggctggaaaccaagt
ggaaaagagagaggtaaagagtccaaagatccagatcagctttacagcacattaaaaacc
atccttcagcaggttaagagccatcaaagcgcttggcccttcatggaacctgtgaagaga
acagaagctcctggatattatgaagttataaggtttcccatggatctaaaaaccatgagc
gagcgactcaagaataggtactacgtgactaagaaattattcatggcagacttacagcgg
gtctttacaaactgcagagagtataatcctcctgagagtgaatactacaaatgtgccaat
atactggagaaattcttctacacaaaaattaaagaagctggattaattgacaaatga

DBGET integrated database retrieval system