KEGG   Alligator sinensis (Chinese alligator): 102367884Help
Entry
102367884         CDS       T02922                                 

Gene name
KAT2B
Definition
(RefSeq) lysine acetyltransferase 2B
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
asn  Alligator sinensis (Chinese alligator)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:asn00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    102367884 (KAT2B)
Enzymes [BR:asn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     102367884 (KAT2B)
Transcription machinery [BR:asn03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     102367884 (KAT2B)
Chromosome [BR:asn03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    102367884 (KAT2B)
   HAT complexes
    PCAF complex
     102367884 (KAT2B)
    STAGA complex
     102367884 (KAT2B)
    TFTC complex
     102367884 (KAT2B)
    SAGA complex
     102367884 (KAT2B)
    SLIK complex
     102367884 (KAT2B)
    ADA-HAT complex
     102367884 (KAT2B)
    HAT-A2 complex
     102367884 (KAT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
Un
AA seq 788 aa AA seqDB search
MWHVGDKLAVADMFNKNSAFQDKHKGFLSKVFSEAIACDDLPKPLVWTSLLNDAKTIWAE
ESCKCNGWKNPNPPPTPPRADLQQTIVSLTEPCRSCSHPLASHVSHLENVSEEEMNRLLG
IVLDVEYLFTCVHKEEDADTKQVYFYLFKLLRKCILQMGKPVVEGSLESPPFEKPSIEQG
VNNFVQYKFSHLPSKERQTIVELAKMFLNRINYWHLEIPSQRRLRSPNDDIAGYKVNYTR
WLCYCNVPQFCDSLPRYETTQVFGRTLLRSVFTVMRRQLLEQARQEKDKLPQEKRTLILT
HFPKFLSMLEEEVYSQNSPIWDQDFMMSSSRTGQLGIQTVINPPPVARSISYSASPSSLE
QPNSGSMSPACKVSSGLDQNLGEKRKNTELYSLEDSKRPRVVGDIPIELINEVMSTITDP
GAMLGPETNFLSAHSARDEAARLEERRGVIEFHVVGNSLNQKPNKKIMMWLVGLQNVFSH
QLPRMPKEYITRLVFDPKHKTLALIKDGRVIGGICFRMFPSQGFTEIVFCAVTSNEQVKG
YGTHLMNHLKEYHIKHNILNFLTYADEYAIGYFKKQGFSKDIKVPKAKYVGYIKDYEGAT
LMGCELNPXXXYTEFSVIIKKQKEIIKKLIERKQAQIRKVYPGLSCFKDGVRQIPIESIP
GIRETGWKPSGKERGKESKDPDQLYSTLKTILQQVKSHQSAWPFMEPVKRTEAPGYYEVI
RFPMDLKTMSERLKNRYYVTKKLFMADLQRVFTNCREYNPPESEYYKCANILEKFFYTKI
KEAGLIDK
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgtggcatgtcggggataaactggctgtggcagatatgttcaacaaaaactcagctttc
caggataaacataaaggtttcctcagtaaagttttctcagaggccattgcctgtgatgac
ttgcccaaacctctggtttggacaagtttactgaacgatgcaaagactatttgggctgaa
gaatcctgtaaatgtaatggctggaaaaatccgaatccacctcctactcctcccagggca
gatctgcaacagacaattgtcagtcttactgaaccatgccgcagttgtagtcatccacta
gcttctcatgtgtctcacttagagaatgtgtctgaagaagaaatgaataggctgttggga
atagtgttggatgtggaatatcttttcacctgtgtccacaaagaagaagatgcggacacc
aaacaagtttacttttacctgttcaagcttttgaggaaatgcattttacagatggggaaa
cctgtagtagaaggatctttggaaagccctccatttgaaaagcccagtattgaacagggg
gtgaataattttgtgcagtacaaatttagccacttaccatcaaaggaaaggcaaacaata
gttgagctagctaaaatgtttttaaaccgcattaactactggcacctggagataccatct
caacgaagattgagatcacctaatgatgatattgctggctataaagtaaattacacaagg
tggctttgttactgtaatgttccccagttctgtgacagtctacctcggtacgaaacaaca
caggtgtttgggagaacactactccgctctgtctttactgttatgaggcgccaactcctg
gaacaggctagacaggaaaaagacaagcttcctcaggagaaacgaacactaattctcacc
cattttccaaagtttttatccatgttagaagaagaagtttatagtcaaaattctcctatt
tgggatcaggatttcatgatgtcctcttctcgaactggtcagctaggaatccaaacagtg
atcaatcctcctcctgtggcaaggtcgatttcgtacagtgcaagtccttcatctcttgaa
caacccaacagtggaagtatgagtcctgcttgtaaggtttcttctggtcttgaccaaaac
ctaggggagaagagaaagaacactgagctttattctctggaggattccaaaaggccaaga
gttgtaggagatattcctattgaattgatcaatgaggtgatgtcaacaattacagatccg
ggtgcaatgctggggccagagactaactttctgtcagcgcactcagcccgggatgaagct
gcgagactggaggagcgcaggggagtgattgaatttcacgtagttggaaattccctgaat
cagaaaccaaacaaaaagattatgatgtggctagttggcttacagaatgtattttcccat
cagctacctagaatgccaaaggaatatattacacgcctggtctttgatccaaaacacaag
acacttgcattaataaaagatggccgtgtgattggtggtatctgtttccggatgttccca
tctcaaggatttacagagattgttttctgtgctgtgacttctaatgaacaagtcaagggt
tatggaactcatctgatgaatcatctgaaagaatatcacattaaacataacattctcaac
ttcctcacatatgcagatgaatatgcaattggctacttcaaaaaacaaggcttctccaaa
gatattaaagtaccaaaagcaaaatatgttggctacatcaaggattacgaaggagctaca
ttaatgggatgtgaattaaatccannnnnnnnctacactgaattttctgtcatcattaaa
aagcaaaaagagatcataaaaaagctgattgaaaggaaacaagctcagattcgaaaagtc
tatcctggtctttcctgcttcaaggatggcgtacgacagattcctattgaaagcattcct
ggaattagagagactggctggaaaccaagtggaaaagagagaggtaaagagtccaaagat
ccagatcagctttacagcacattaaaaaccatccttcagcaggttaagagccatcaaagc
gcttggcccttcatggaacctgtgaagagaacagaagctcctggatattatgaagttata
aggtttcccatggatctaaaaaccatgagcgagcgactcaagaataggtactacgtgact
aagaaattattcatggcagacttacagcgggtctttacaaactgcagagagtataatcct
cctgagagtgaatactacaaatgtgccaatatactggagaaattcttctacacaaaaatt
aaagaagctggattaattgacaaatga

DBGET integrated database retrieval system